Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.72105441151999E-27
posterior fossa group A ependymoma 1511 7.10576319781611E-11
ovarian cancer 8492 1.50829815685928E-8
osteosarcoma 7933 4.76553223683579E-6
atypical teratoid / rhabdoid tumor 4369 1.00685132236801E-5
medulloblastoma 1524 6.73689751855783E-5
Pick disease 1893 8.71201598768164E-5
adult high grade glioma 2148 8.77529659199167E-5
medulloblastoma, large-cell 6234 3.01090581737907E-4
glioblastoma 5572 4.44997434023123E-4
Rheumatoid Arthritis 1171 0.00322939023081678

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.003
osteosarcoma 2.427 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.100 0.000
posterior fossa group A ependymoma -1.100 0.000
lung carcinoma 1.100 0.000
Pick disease 1.200 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q6PL24 B3KTI6 Q3MJB0 Q9P1V9
Symbols FAM15B

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSDLQAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEPCSSPHRPQMV      1 - 70
SPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQVLNEMAKYQVPQRSGDIVMIQSEHTGAIDVLSADL     71 - 140
ESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKLGKEKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFAT    141 - 210
DDYDIGFGVYFDWTPVTSTDITVQVSDSSDDEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGEVMPVY    211 - 280
RRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYTS                             281 - 325
//

Text Mined References (8)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.