Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.003
osteosarcoma 2.427 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.100 0.000
posterior fossa group A ependymoma -1.100 0.000
lung carcinoma 1.100 0.000
Pick disease 1.200 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q6PL24 B3KTI6 Q3MJB0 Q9P1V9
Symbols FAM15B

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSDLQAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEPCSSPHRPQMV      1 - 70
SPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQVLNEMAKYQVPQRSGDIVMIQSEHTGAIDVLSADL     71 - 140
ESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKLGKEKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFAT    141 - 210
DDYDIGFGVYFDWTPVTSTDITVQVSDSSDDEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGEVMPVY    211 - 280
RRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYTS                             281 - 325
//

Text Mined References (8)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.