Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 8.8e-05
atypical teratoid / rhabdoid tumor -1.400 1.0e-05
glioblastoma -1.200 4.4e-04
group 4 medulloblastoma -1.100 7.4e-06
lung carcinoma 1.100 4.7e-27
medulloblastoma, large-cell -1.200 3.0e-04
osteosarcoma 2.427 4.8e-06
ovarian cancer -1.900 1.5e-08
Pick disease 1.200 8.7e-05
posterior fossa group A ependymoma -1.100 7.1e-11
Rheumatoid arthritis 2.000 3.2e-03

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSDLQAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEPCSSPHRPQMV      1 - 70
SPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQVLNEMAKYQVPQRSGDIVMIQSEHTGAIDVLSADL     71 - 140
ESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKLGKEKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFAT    141 - 210
DDYDIGFGVYFDWTPVTSTDITVQVSDSSDDEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGEVMPVY    211 - 280
RRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYTS                             281 - 325
//

Text Mined References (8)

PMID Year Title