Property Summary

Ligand Count 15
NCBI Gene PubMed Count 36
PubMed Score 209.30
PubTator Score 73.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
lung cancer 1.600 5.2e-03
active Crohn's disease 1.077 8.0e-03
adrenocortical carcinoma 1.488 8.1e-03
Atopic dermatitis 1.100 6.6e-05
atypical teratoid/rhabdoid tumor 1.100 2.8e-04
Breast cancer 2.000 4.0e-12
breast carcinoma 1.600 4.8e-34
ductal carcinoma in situ 1.800 1.2e-02
ependymoma 1.100 1.5e-05
glioblastoma 1.400 1.9e-06
group 3 medulloblastoma 2.200 6.6e-05
intraductal papillary-mucinous carcinoma... 2.000 4.2e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.3e-03
invasive ductal carcinoma 3.000 4.2e-04
malignant mesothelioma 1.500 8.4e-07
medulloblastoma, large-cell 2.000 4.5e-06
nasopharyngeal carcinoma 1.300 5.8e-05
non-small cell lung cancer 2.565 2.8e-28
oligodendroglioma 1.100 4.9e-07
ovarian cancer 1.800 1.0e-03
pancreatic cancer 1.100 7.9e-04
pediatric high grade glioma 1.300 3.6e-04
primitive neuroectodermal tumor 1.500 3.7e-03
tuberculosis and treatment for 6 months 1.300 1.5e-04
ulcerative colitis 1.100 7.1e-05

Gene RIF (26)

AA Sequence

MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHR      1 - 70
TRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEEHREDKVIPVTRSLRARNIVQ     71 - 140
STEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNTAEAVLQKMDDMKKMRRQRMRELEDLGVFNE    141 - 210
TEESNLNMYTRGKQKDIQRTDEETTDNQEGSVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDD    211 - 280
EDEEDGEEENQKRYYLRQRKATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNR    281 - 350
RRHAIHSSDSTSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD    351 - 420
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKR    421 - 490
VAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMD    491 - 560
GLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPLDTFLEELAEN    561 - 630
CVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQA    631 - 700
LSTVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHK    701 - 770
AKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE    771 - 840
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQEL    841 - 910
FIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSLTAEEVKRLEE    911 - 980
QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYL    981 - 1050
RDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1051 - 1120
SYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDS   1121 - 1190
QNAIDHKIESDTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA   1191 - 1260
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILSQPTPSLVVDH   1261 - 1330
ERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKMEQEVENFSCSR             1331 - 1390
//

Text Mined References (51)

PMID Year Title