Property Summary

NCBI Gene PubMed Count 30
PubMed Score 150.91
PubTator Score 73.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 2.82142391575725E-32
non-small cell lung cancer 2798 2.77584406960471E-28
Breast cancer 3099 4.02293429745938E-12
oligodendroglioma 2849 4.91696137366978E-7
malignant mesothelioma 3163 8.35703708893602E-7
glioblastoma 5572 1.94958583576983E-6
nasopharyngeal carcinoma 1056 2.63009062418226E-6
medulloblastoma, large-cell 6234 4.54225673658052E-6
ependymoma 2514 1.45206782978321E-5
lung cancer 4473 3.84962382616241E-5
ulcerative colitis 2087 5.0989344721127E-5
Atopic dermatitis 944 6.61148508836342E-5
group 3 medulloblastoma 2254 6.63534745206141E-5
tuberculosis and treatment for 6 months 686 1.48464652589659E-4
atypical teratoid/rhabdoid tumor 1095 2.78098937763903E-4
pediatric high grade glioma 2712 3.60859221832783E-4
invasive ductal carcinoma 2950 4.20470270981812E-4
pancreatic cancer 2300 7.93951438575925E-4
ovarian cancer 8492 0.001018719420379
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0025756919030541
adrenocortical carcinoma 1427 0.00296662140374196
primitive neuroectodermal tumor 3031 0.00371870961355318
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00419301627353064
active Crohn's disease 918 0.00823449795465809
ductal carcinoma in situ 1745 0.0122726629690307
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q6PL18 Q14CR1 Q658P2 Q68CQ0 Q6PJV6 Q8N890 Q9UHS5
Symbols ANCCA
CT137
PRO2000

Gene

PANTHER Protein Class (1)

PDB

3DAI   4QSP   4QSQ   4QSR   4QSS   4QST   4QSU   4QSV   4QSW   4QSX   4QUT   4QUU   4TT2   4TT4   4TT6   4TTE   4TU4   4TU6   4TYL   4TZ2   4TZ8   5A5N   5A5O   5A5P   5A5Q   5A5R   5A81   5A82   5A83   5LJ0  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (21)

PMID Text
26819280 Results showed that ATPase family AAA domain-containing 2 overexpression was associated with progression and prognosis of colorectal cancer.
26497681 Suppression of ATAD2 impaired the growth of HepG2 and Hep3B subcutaneous xenografts, by enhancing apoptosis and p-p53 and p-p38 levels.
26308378 Data indicate that gene expression alterations in endometrial carcinoma samples with high ATPase family, AAA domain containing 2 protein (ATAD2) expression showed upregulation of several cancer-related genes including B-MYB gene.
25934333 We identified ANCCA protein expression as a novel independent poor prognostic indicator in endometrial carcinoma
25813398 Cervical cancer tissues may have highly expressed ATAD2. Oncogene ATAD2 may play an important role in cervical cancer proliferation, invasion and migration.
25377252 Data highlight the implication of Yta7 not only in gene expression, as expected, but also in genome organization, as a possible histone chaperone acting at boundary sites and regulating transcription. [review]
24805933 Results found that ATAD2 is highly expressed in hepatocellular carcinoma tissues and could affect the expression of hedghog pathway.
24761900 High expression of ATAD2 is associated with ovarian carcinomas
24552534 miR-372 suppressed the expression of ATAD2, which was highly expressed in HCC and exerted a proto-oncogene effect in hepatic carcinogenesis.
24391143 Study reveals ANCCA as a key mediator of kinesin family deregulation in breast cancer and the crucial role of multiple kinesins in growth and survival of the tumor cells.
More...

AA Sequence

MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHR      1 - 70
TRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEEHREDKVIPVTRSLRARNIVQ     71 - 140
STEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNTAEAVLQKMDDMKKMRRQRMRELEDLGVFNE    141 - 210
TEESNLNMYTRGKQKDIQRTDEETTDNQEGSVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDD    211 - 280
EDEEDGEEENQKRYYLRQRKATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNR    281 - 350
RRHAIHSSDSTSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD    351 - 420
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKR    421 - 490
VAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMD    491 - 560
GLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHTRDWNPKPLDTFLEELAEN    561 - 630
CVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQA    631 - 700
LSTVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHK    701 - 770
AKDNFNFLHLNRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE    771 - 840
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQEL    841 - 910
FIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSLTAEEVKRLEE    911 - 980
QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYL    981 - 1050
RDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP   1051 - 1120
SYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDS   1121 - 1190
QNAIDHKIESDTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA   1191 - 1260
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILSQPTPSLVVDH   1261 - 1330
ERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKMEQEVENFSCSR             1331 - 1390
//

Text Mined References (44)

PMID Year Title
26819280 2016 ATAD2 overexpression is associated with progression and prognosis in colorectal cancer.
26497681 2015 Suppression of ATAD2 inhibits hepatocellular carcinoma progression through activation of p53- and p38-mediated apoptotic signaling.
26308378 2015 ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.
25934333 2015 Overexpression of ANCCA/ATAD2 in endometrial carcinoma and its correlation with tumor progression and poor prognosis.
25813398 2015 Oncogene ATAD2 promotes cell proliferation, invasion and migration in cervical cancer.
25377252 2014 Lessons from yeast on emerging roles of the ATAD2 protein family in gene regulation and genome organization.
24805933 2014 Epigenetic high regulation of ATAD2 regulates the Hh pathway in human hepatocellular carcinoma.
24761900 2014 ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis.
24552534 2014 miR-372 down-regulates the oncogene ATAD2 to influence hepatocellular carcinoma proliferation and metastasis.
24391143 2014 Kinesin family deregulation coordinated by bromodomain protein ANCCA and histone methyltransferase MLL for breast cancer cell growth, survival, and tamoxifen resistance.
More...