Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
23036705 DHRS4L2 is a duplicate syntenic form of the human DHRS4 gene.

AA Sequence

MARLLGLCAWARKSVRLASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQA      1 - 70
VATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINV     71 - 140
KAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHL    141 - 210
DLSRLASAGCSGWTRKKRKA                                                      211 - 230
//

Text Mined References (14)

PMID Year Title
23036705 2012 Molecular and functional evolution of human DHRS2 and DHRS4 duplicated genes.
20525226 2010 Bioinformatic analysis of the human DHRS4 gene cluster and a proposed mechanism for its transcriptional regulation.
18754758 2009 Alternative transcription initiation and splicing variants of the DHRS4 gene cluster.
17230527 2007 Expression of a novel alternatively spliced variant of NADP(H)-dependent retinol dehydrogenase/reductase with deletion of exon 3 in cervical squamous carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16204458 2005 Non-EST based prediction of exon skipping and intron retention events using Pfam information.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15473316 2004 CDNA cloning of a short isoform of human liver NADP (H) -dependent retinol dehydrogenase/reductase and analysis of its characteristics.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...