Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.03
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MARLLGLCAWARKSVRLASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQA      1 - 70
VATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINV     71 - 140
KAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHL    141 - 210
DLSRLASAGCSGWTRKKRKA                                                      211 - 230
//

Text Mined References (14)

PMID Year Title