Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.02
PubTator Score 0.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6PK81 Q96DL8
Symbols ZNF419B

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Cow OMA EggNOG Inparanoid

AA Sequence

MAAATLRDPAQQGYVTFEDVAVYFSQEEWRLLDDAQRLLYRNVMLENFTLLASLGLASSKTHEITQLESW      1 - 70
EEPFMPAWEVVTSAILRGSWQGAKAEAAAEQSASVEVPSSNVQQHQKQHCGEKPLKRQEGRVPVLRSCRV     71 - 140
HLSEKSLQSREVGKDLLTSSGVLKHQVTHTGEKSHRSSKSREAFHAGKRHYKCSECGKAFGQKYLLVQHQ    141 - 210
RLHTGEKPYECSECGKLFSHKSNLFIHQIVHTGERPYGCSDCGKSFSRNADLIQHQRVHTGEKPFTCSEC    211 - 280
GKAFRHNSTLVQHHRIHTGVRPYECSECGKLFSFNSSLMKHQRVHTGERPYKCSECGKFYSHKSSLINHW    281 - 350
RVHTGERPYECSECGKFFSQSSSLMQHRKVHTGEKPFKCNECGRFFSENSSLVKHQRVHTGAKPYECREC    351 - 420
GKFFRHSSSLVKHRRIHTGEIQ                                                    421 - 442
//

Text Mined References (4)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.