Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.4e-08
psoriasis 6694 2.8e-05
medulloblastoma, large-cell 6241 3.7e-05
diabetes mellitus 1728 2.6e-03

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.700 2.6e-03
medulloblastoma, large-cell 1.200 3.7e-05
osteosarcoma 1.601 1.4e-08
psoriasis -1.100 2.8e-05

AA Sequence

MPSCSPQQASKAEENGSNSFMHSMVPQLEWQMETTQSLVDSYVAIVNKTVWDLMVGLTPKTIMHLMINNN      1 - 70
KEFIFSELLANLYLHGDKNMLMEESAEQAQRS                                           71 - 102
//

Text Mined References (3)

PMID Year Title