Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.601 0.000
medulloblastoma, large-cell 1.200 0.000
diabetes mellitus 1.700 0.003
psoriasis -1.100 0.000

AA Sequence

MPSCSPQQASKAEENGSNSFMHSMVPQLEWQMETTQSLVDSYVAIVNKTVWDLMVGLTPKTIMHLMINNN      1 - 70
KEFIFSELLANLYLHGDKNMLMEESAEQAQRS                                           71 - 102
//

Text Mined References (3)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15008788 2004 DNM1DN: a new class of paralogous genomic segments (duplicons) with highly conserved copies on chromosomes Y and 15.