Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.04
PubTator Score 1.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 6.8e-14
osteosarcoma 7950 1.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.200 6.8e-14
osteosarcoma -1.561 1.9e-04

Synonym

Accession Q6PK04
Symbols RaRF

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAGAGRGAAVSRVQAGPGSPRRARGRQQVQPLGKQRPAPWPGLRSKEKKKVNCKPKNQDEQEIPFRLREI      1 - 70
MRSRQEMKNPISNKKRKKAAQVTFRKTLEKEAKGEEPDIAVPKFKQRKGESDGAYIHRMQQEAQHVLFLS     71 - 140
KNQAIRQPEVQAAPKEKSEQKKAKKAFQKRRLDKVRRKKEEKAADRLEQELLRDTVKFGEVVLQPPELTA    141 - 210
RPQRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLT    211 - 280
SRKKPEPQL                                                                 281 - 289
//

Text Mined References (15)

PMID Year Title