Property Summary

NCBI Gene PubMed Count 15
PubMed Score 59.56
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.900 3.8e-07
astrocytic glioma -1.200 8.2e-03
Astrocytoma, Pilocytic -1.400 6.7e-08
atypical teratoid / rhabdoid tumor -1.700 5.7e-09
chronic rhinosinusitis -1.269 1.5e-03
cystic fibrosis and chronic rhinosinusit... -1.142 3.7e-03
ependymoma -1.400 1.9e-10
glioblastoma -1.400 2.0e-07
group 4 medulloblastoma -1.300 1.5e-04
medulloblastoma, large-cell -1.700 5.7e-06
osteosarcoma 1.260 1.6e-03
ovarian cancer 1.200 1.7e-08
primitive neuroectodermal tumor -1.200 2.9e-03
spina bifida -1.168 4.8e-02
subependymal giant cell astrocytoma -1.327 3.7e-02
tuberculosis and treatment for 6 months 1.200 9.5e-04

Gene RIF (2)

AA Sequence

MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGKPQVSEQDSLN      1 - 70
NNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGTAKKIPPGLFSGDIAPLMQEK     71 - 140
VLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAM    141 - 210
KFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHK    211 - 280
IAAVEKSQERKCSTQLLVSEDPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPS    281 - 350
LSVTAGKDHMEELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAED    351 - 420
PKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNELNELQQPDLT    421 - 490
DSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQLNKETEDYLNSLLEGCLKDTE    491 - 560
DSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLSLDDLAKRIEIAEVVPTEGLVSILKKRNDTV    561 - 630
GDHPAQMQHKPSKRRVRFQEIDDSLDQDEVGGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDF    631 - 700
ADNMDFYYTKLLQGVAELKHWIYLS                                                 701 - 725
//

Text Mined References (19)

PMID Year Title