Property Summary

NCBI Gene PubMed Count 15
Grant Count 45
R01 Count 30
Funding $15,176,598.71
PubMed Score 58.66
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (2)

PMID Text
19864490 Consortin is a trans-Golgi network cargo receptor for the plasma membrane targeting and recycling of connexins.
18854154 Knockdown of consortin, connexin sorting protein (CNST; C1orf71) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGKPQVSEQDSLN      1 - 70
NNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGTAKKIPPGLFSGDIAPLMQEK     71 - 140
VLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAM    141 - 210
KFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHK    211 - 280
IAAVEKSQERKCSTQLLVSEDPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPS    281 - 350
LSVTAGKDHMEELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAED    351 - 420
PKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNELNELQQPDLT    421 - 490
DSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQLNKETEDYLNSLLEGCLKDTE    491 - 560
DSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLSLDDLAKRIEIAEVVPTEGLVSILKKRNDTV    561 - 630
GDHPAQMQHKPSKRRVRFQEIDDSLDQDEVGGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDF    631 - 700
ADNMDFYYTKLLQGVAELKHWIYLS                                                 701 - 725
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19946888 2010 Defining the membrane proteome of NK cells.
19864490 2010 Consortin, a trans-Golgi network cargo receptor for the plasma membrane targeting and recycling of connexins.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
More...