Property Summary

NCBI Gene PubMed Count 15
PubMed Score 58.66
PubTator Score 5.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Thyroid Diseases 12
Disease Target Count P-value
ependymoma 2514 1.91805353436199E-10
osteosarcoma 7933 1.23206117967861E-9
atypical teratoid / rhabdoid tumor 4369 5.68155352501552E-9
ovarian cancer 8492 4.92443360744897E-8
pilocytic astrocytoma 3086 6.04465988301566E-8
glioblastoma 5572 2.81231222025297E-7
adult high grade glioma 2148 3.80181344007483E-7
medulloblastoma, large-cell 6234 5.69625690024676E-6
medulloblastoma 1524 8.61495626572354E-6
chronic rhinosinusitis 512 5.0433657959949E-4
tuberculosis and treatment for 6 months 686 9.49103742262214E-4
primitive neuroectodermal tumor 3031 0.00290625014606199
cystic fibrosis and chronic rhinosinusitis 213 0.00374524696422628
astrocytic glioma 2241 0.00818860925243302
subependymal giant cell astrocytoma 2287 0.018519896010119
spina bifida 1064 0.023029725387921
Disease Target Count Z-score Confidence
Spinal cancer 3 4.007 2.0
Lymphoma 57 3.184 1.6

Expression

  Differential Expression (16)

Synonym

Accession Q6PJW8 Q5VSY9 Q5VTM7 Q8IYA9 Q8N3L5 Q8NB09 Q8TEI2 Q96MR5
Symbols C1orf71
PPP1R64

Gene

  Ortholog (11)

Gene RIF (2)

PMID Text
19864490 Consortin is a trans-Golgi network cargo receptor for the plasma membrane targeting and recycling of connexins.
18854154 Knockdown of consortin, connexin sorting protein (CNST; C1orf71) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGKPQVSEQDSLN      1 - 70
NNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGTAKKIPPGLFSGDIAPLMQEK     71 - 140
VLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAM    141 - 210
KFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHK    211 - 280
IAAVEKSQERKCSTQLLVSEDPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPS    281 - 350
LSVTAGKDHMEELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAED    351 - 420
PKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNELNELQQPDLT    421 - 490
DSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQLNKETEDYLNSLLEGCLKDTE    491 - 560
DSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLSLDDLAKRIEIAEVVPTEGLVSILKKRNDTV    561 - 630
GDHPAQMQHKPSKRRVRFQEIDDSLDQDEVGGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDF    631 - 700
ADNMDFYYTKLLQGVAELKHWIYLS                                                 701 - 725
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19946888 2010 Defining the membrane proteome of NK cells.
19864490 2010 Consortin, a trans-Golgi network cargo receptor for the plasma membrane targeting and recycling of connexins.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
More...