Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.22
PubTator Score 10.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 1.5e-03
atypical teratoid / rhabdoid tumor -1.800 7.6e-05
ependymoma -1.100 1.5e-04
glioblastoma -1.400 7.8e-06
group 3 medulloblastoma 1.100 2.0e-02
medulloblastoma, large-cell -1.800 4.3e-04
osteosarcoma 1.320 4.3e-04
ovarian cancer -1.300 1.6e-05
Pick disease 1.200 1.0e-03
progressive supranuclear palsy 1.300 5.3e-03
ulcerative colitis -1.011 2.4e-02

Gene RIF (7)

AA Sequence

MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVL      1 - 70
DKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKT     71 - 140
TNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRP    141 - 210
SIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNN    211 - 280
SEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQA    281 - 350
NKNLILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGD    351 - 420
SVEKNQGTQQRQLLSRLQIDPVMAETLQMSQDYYDMESMVHADTRSFILKKPKLSEEVVVAPNQESGMKT    421 - 490
ADSLRVLSGHLMQTRDLVQPDKPASPKFIVTLDGVPSPPGYMSDQEEDMCFEGMKPVNQTAASNKGLRGL    491 - 560
LHPQQLHLLSRQLEDPNGSFSNAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKF    561 - 630
AEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKPAVAPPAPPSSSQLCRYFPACKKMECPFYHPKH    631 - 700
CRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE                                      701 - 736
//

Text Mined References (38)

PMID Year Title