Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.25
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.284 6.2e-09
astrocytic glioma 1.300 5.2e-03
dermatomyositis 1.300 1.3e-04
gastric carcinoma 1.100 7.5e-03
intraductal papillary-mucinous adenoma (... 1.200 1.1e-04
lung carcinoma 1.300 8.4e-26
oligodendroglioma 1.100 4.4e-03
osteosarcoma -1.431 2.0e-03
ovarian cancer -1.800 7.4e-09
Pick disease -1.100 6.7e-05

Protein-protein Interaction (9)

Gene RIF (2)

AA Sequence

MAARWSSENVVVEFRDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPH      1 - 70
DSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTYIYIWDIKDTRK     71 - 140
PTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHILATS    141 - 210
SQDNSVKFWDYRQPRKYLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVG    211 - 280
HDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEFIESISLLPEPEKTLH    281 - 350
TEDTDHQHTASHGEEEALKEDPPRNLLEERKSDQLGLPQTLQQEFSLINVQIRNVNVEMDAADRSCTVSV    351 - 420
HCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCLEPCLRQLVSC    421 - 490
LESFVNQEDSASSNPFALPNSVTPPLPTFARVTTAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMH    491 - 560
RAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSK    561 - 630
REGSDSGNRQIKAAGKVIIQDIACLLPVHKSLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLAT    631 - 700
VATDLCLGPKSDPDLETPWARHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPN    701 - 770
RSSNLVVSHSRYPSFTSSGSCSSMSDPGLNTGGWNIAGREAEHLSSPWGESSPEELRFGSLTYSDPRERE    771 - 840
RDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGVYCSHCRSEVR    841 - 910
GTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWFRTQEVCPTGCGCHCLLESTF          911 - 974
//

Text Mined References (22)

PMID Year Title