Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.34
PubTator Score 2.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.9e-08
osteosarcoma 7950 5.8e-07
Breast cancer 3578 2.9e-04
Disease Target Count Z-score Confidence
Salmonellosis 42 3.001 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.100 2.9e-04
osteosarcoma 1.214 5.8e-07
ovarian cancer 1.200 1.9e-08

Gene RIF (4)

AA Sequence

MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQALGPPDFRN      1 - 70
MTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPVNLQHLILSGNQLGRIAPGAF     71 - 140
DDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNLIDALPPGAFAQLGQLSRLDLTSNRLATLAP    141 - 210
DPLFSRGRDAEASPAPLVLSFSGNPLHCNCELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEP    211 - 280
PLIARHTQRLWVLEGQRATLRCRALGDPAPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYT    281 - 350
CIATNPAGEATARVELRVLALPHGGNSSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGL    351 - 420
VSWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPAAGPSDLTATR    421 - 490
LLGCAHFSTLPASPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVRGRGAGNGRLPLKLSHVQSQT    491 - 560
NGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRLGGAWARRSHSVHGGLLGAGCRGVGGSAERL    561 - 630
EESVV                                                                     631 - 635
//

Text Mined References (14)

PMID Year Title