Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.80
PubTator Score 10.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
lung adenocarcinoma 2716 4.9e-11
breast carcinoma 1638 9.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Epilepsy 792 3.235 1.6
Disease Target Count Z-score Confidence
Microcephaly 166 4.35 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.700 9.0e-03
lung adenocarcinoma 1.300 4.9e-11

Gene RIF (10)

AA Sequence

MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSS      1 - 70
GVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFL     71 - 140
ADHGAVDTIFSLQGDSSLFVASAASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAA    141 - 210
TPKVTQALNVLTTTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLW    211 - 280
ETVARALSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATT    281 - 350
VDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLRLCDGSAAPASSVGGHLCGTLA    351 - 420
GCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDL    421 - 490
GPLIPQFLRELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESY    491 - 560
VRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQD    561 - 630
TEQFVATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGL    631 - 700
FDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPE    701 - 770
AVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY                       771 - 821
//

Text Mined References (30)

PMID Year Title