Property Summary

NCBI Gene PubMed Count 19
PubMed Score 33.50
PubTator Score 47.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.300 5.3e-05
breast carcinoma 1.100 1.6e-02
Chronic Lymphocytic Leukemia -1.340 5.4e-03
group 4 medulloblastoma -1.100 1.5e-03
invasive ductal carcinoma 1.024 1.7e-03
malignant mesothelioma -2.400 2.5e-08
ovarian cancer 1.400 1.2e-05
pancreatic ductal adenocarcinoma liver m... 1.385 2.4e-03
psoriasis 1.600 8.5e-04

 GO Function (1)

 CSPA Cell Line (3)

Gene RIF (10)

AA Sequence

MASADKNGGSVSSVSSSRLQSRKPPNLSITIPPPEKETQAPGEQDSMLPEGFQNRRLKKSQPRTWAAHTT      1 - 70
ACPPSFLPKRKNPAYLKSVSLQEPRSRWQESSEKRPGFRRQASLSQSIRKGAAQWFGVSGDWEGQRQQWQ     71 - 140
RRSLHHCSMRYGRLKASCQRDLELPSQEAPSFQGTESPKPCKMPKIVDPLARGRAFRHPEEMDRPHAPHP    141 - 210
PLTPGVLSLTSFTSVRSGYSHLPRRKRMSVAHMSLQAAAALLKGRSVLDATGQRCRVVKRSFAFPSFLEE    211 - 280
DVVDGADTFDSSFFSKEEMSSMPDDVFESPPLSASYFRGIPHSASPVSPDGVQIPLKEYGRAPVPGPRRG    281 - 350
KRIASKVKHFAFDRKKRHYGLGVVGNWLNRSYRRSISSTVQRQLESFDSHRPYFTYWLTFVHVIITLLVI    351 - 420
CTYGIAPVGFAQHVTTQLVLRNKGVYESVKYIQQENFWVGPSSIDLIHLGAKFSPCIRKDGQIEQLVLRE    421 - 490
RDLERDSGCCVQNDHSGCIQTQRKDCSETLATFVKWQDDTGPPMDKSDLGQKRTSGAVCHQDPRTCEEPA    491 - 560
SSGAHIWPDDITKWPICTEQARSNHTGFLHMDCEIKGRPCCIGTKGSCEITTREYCEFMHGYFHEEATLC    561 - 630
SQVHCLDKVCGLLPFLNPEVPDQFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILS    631 - 700
GITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWPLLERPWKAFLNLSAIVLFLFICGLLPWIDN    701 - 770
IAHIFGFLSGLLLAFAFLPYITFGTSDKYRKRALILVSLLAFAGLFAALVLWLYIYPINWPWIEHLTCFP    771 - 840
FTSRFCEKYELDQVLH                                                          841 - 856
//

Text Mined References (25)

PMID Year Title