Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.58
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
16702234 We observed functional nuclear pore complexes and intact nuclear envelopes in severely POM121-depleted cells.

AA Sequence

MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDG      1 - 70
QENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSF     71 - 140
SKPSNSWFPVEGLADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASL                           141 - 187
//

Text Mined References (4)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
7789967 1995 POM-ZP3, a bipartite transcript derived from human ZP3 and a POM121 homologue.