Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.58
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6PJE2 F6STJ3 Q12903 Q9BWB4 POM-ZP3
Symbols POM121
POM-ZP3

Gene

Gene RIF (1)

PMID Text
16702234 We observed functional nuclear pore complexes and intact nuclear envelopes in severely POM121-depleted cells.

AA Sequence

MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDG      1 - 70
QENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSF     71 - 140
SKPSNSWFPVEGLADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASL                           141 - 187
//

Text Mined References (4)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
7789967 1995 POM-ZP3, a bipartite transcript derived from human ZP3 and a POM121 homologue.