Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.13
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 4.4e-04
Disease Target Count Z-score Confidence
Disease of mental health 36 0.0 3.0
Disease Target Count Z-score Confidence
hand, foot and mouth disease 13 3.287 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.012 4.4e-04

Gene RIF (3)

AA Sequence

MAAQLLEEKLTCAICLGLYQDPVTLPCGHNFCGACIRDWWDRCGKACPECREPFPDGAELRRNVALSGVL      1 - 70
EVVRAGPARDPGPDPGPGPDPAARCPRHGRPLELFCRTEGRCVCSVCTVRECRLHERALLDAERLKREAQ     71 - 140
LRASLEVTQQQATQAEGQLLELRKQSSQIQNSACILASWVSGKFSSLLQALEIQHTTALRSIEVAKTQAL    141 - 210
AQARDEEQRLRVHLEAVARHGCRIRELLEQVDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLL    211 - 280
SRLCGLLLEEGSHPGAPAKPVDLAPVEAPGPLAPVPSTVCPLRRKLWQNYRNLTFDPVSANRHFYLSRQD    281 - 350
QQVKHCRQSRGPGGPGSFELWQVQCAQSFQAGHHYWEVRASDHSVTLGVSYPQLPRCRLGPHTDNIGRGP    351 - 420
CSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFW    421 - 490
LLEGRTLTLCHQPGAVFPLGPQEEVLS                                               491 - 517
//

Text Mined References (10)

PMID Year Title