Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.38
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.012 0.000

Gene RIF (2)

PMID Text
27012201 TRIM65 is a potential oncogenic protein, highly likely through p53 inactivation
24778252 TRIM65 relieves miRNA-driven suppression of mRNA expression through ubiquitination and subsequent degradation of TNRC6.

AA Sequence

MAAQLLEEKLTCAICLGLYQDPVTLPCGHNFCGACIRDWWDRCGKACPECREPFPDGAELRRNVALSGVL      1 - 70
EVVRAGPARDPGPDPGPGPDPAARCPRHGRPLELFCRTEGRCVCSVCTVRECRLHERALLDAERLKREAQ     71 - 140
LRASLEVTQQQATQAEGQLLELRKQSSQIQNSACILASWVSGKFSSLLQALEIQHTTALRSIEVAKTQAL    141 - 210
AQARDEEQRLRVHLEAVARHGCRIRELLEQVDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLL    211 - 280
SRLCGLLLEEGSHPGAPAKPVDLAPVEAPGPLAPVPSTVCPLRRKLWQNYRNLTFDPVSANRHFYLSRQD    281 - 350
QQVKHCRQSRGPGGPGSFELWQVQCAQSFQAGHHYWEVRASDHSVTLGVSYPQLPRCRLGPHTDNIGRGP    351 - 420
CSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFW    421 - 490
LLEGRTLTLCHQPGAVFPLGPQEEVLS                                               491 - 517
//

Text Mined References (9)

PMID Year Title
27012201 2016 TRIM65 negatively regulates p53 through ubiquitination.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
24778252 2014 TRIM65 regulates microRNA activity by ubiquitination of TNRC6.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21681796 2011 Genome-wide association studies of cerebral white matter lesion burden: the CHARGE consortium.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.