Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.51530361842E-5
lung cancer 4473 3.15140111588612E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00261866571007663

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.003
lung cancer 1.500 0.000

Synonym

Accession Q6PJ61
Symbols Fbx46
FBXO34L
20D7-FC4

Gene

  Ortholog (8)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MDRGSLLPFQLWCPRPFGTYSQNQPRPPSAALKPSACPEPGGGAEPDHGPAHSENTPPALATEVPASQPA      1 - 70
PLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKVKGHWGSDSSKAKRRRRCLDP     71 - 140
TKAPPDPGGREGPPAAEEGPASAGEDVDLLSVAEMVALVEQRAALALQSYPRPTTPAPVVFVSAEQGGPA    141 - 210
KGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPDSGLPS    211 - 280
GGGGRPGCAYPGSPGPGARAKDKITCDLYQLISPSRDALPSNVEFLLARADEASEGDSPAPARPEDTPPA    281 - 350
PPPPPARDCGASGFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRGPDGPP    351 - 420
EPPPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHVLVKIFSFLPT    421 - 490
RALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKGDVSLCRWHPKPYHHDLPYGR    491 - 560
SYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGREEGR                               561 - 603
//

Text Mined References (11)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...