Property Summary

NCBI Gene PubMed Count 12
Grant Count 144
R01 Count 53
Funding $16,085,828.21
PubMed Score 371.52
PubTator Score 20.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 3.300 0.001
osteosarcoma -3.522 0.000
tuberculosis -1.600 0.000
lung cancer -1.900 0.049
sarcoidosis 1.800 0.047
interstitial cystitis 2.100 0.013
primary Sjogren syndrome 2.000 0.004
lung carcinoma -2.000 0.000

Synonym

Accession Q6PIZ9 Q9NZX5
Symbols TRIM
TCRIM
HSPC062
pp29/30

Gene

Gene RIF (3)

PMID Text
23969027 TRIM proteins trim the balance of homoeostasis by modulating various biological pathways through protein-protein interactions.
23699904 MG53/TRIM72 protein can be directly applied as a therapeutic agent to increase membrane repair capacity of many cell types.
18817831 TRIM acts to chaperone CTLA-4 transport to the cell surface; this function would be required to account for the phenotypic and functional properties of CD8(+) Tregs.

AA Sequence

MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMI      1 - 70
SEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQL     71 - 140
HAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN                            141 - 186
//

Text Mined References (12)

PMID Year Title
23969027 2013 TRIM proteins as trim tabs for the homoeostasis.
23699904 2013 TRIM proteins in therapeutic membrane repair of muscular dystrophy.
18817831 2008 Human leukocyte antigen class I-restricted immunosuppression by human CD8+ regulatory T cells requires CTLA-4-mediated interaction with dendritic cells.
16160011 2006 Transmembrane adaptor molecules: a new category of lymphoid-cell markers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12660731 2003 The role of PI3K in immune cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11390434 2001 The transmembrane adaptor protein TRIM regulates T cell receptor (TCR) expression and TCR-mediated signaling via an association with the TCR zeta chain.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10723796 2000 The role of membrane-associated adaptors in T cell receptor signalling.
More...