Property Summary

NCBI Gene PubMed Count 12
PubMed Score 413.61
PubTator Score 20.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.0e-12
osteosarcoma 7950 7.9e-05
tuberculosis 2010 3.5e-04
cutaneous lupus erythematosus 1057 8.0e-04
primary Sjogren syndrome 735 4.4e-03
interstitial cystitis 2312 1.3e-02
lung cancer 4740 3.2e-02
sarcoidosis 370 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Mulibrey nanism 13 4.093 2.0
Cancer 2499 3.705 1.9

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 3.300 8.0e-04
interstitial cystitis 2.100 1.3e-02
lung cancer -1.200 3.2e-02
lung carcinoma -2.000 1.0e-12
osteosarcoma -3.522 7.9e-05
primary Sjogren syndrome 2.000 4.4e-03
sarcoidosis 1.800 4.7e-02
tuberculosis -1.600 3.5e-04

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMI      1 - 70
SEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQL     71 - 140
HAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN                            141 - 186
//

Text Mined References (12)

PMID Year Title