Property Summary

NCBI Gene PubMed Count 17
Grant Count 34
R01 Count 17
Funding $3,248,998.05
PubMed Score 33.95
PubTator Score 15.55

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26926106 QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
24667324 HBx is a critical protein derived from HBV, which regulates miR-122 via down-regulating Gld2
23200856 The noncanonical polymerase Gld2 has been implicated in the stabilization of miR-122, possibly through catalyzing 3' monoadenylation
23063654 Study identified TUT7, TUT4, and TUT2 as novel components of the miRNA biogenesis pathway.
22727665 poly(A) polymerase Gld2, deadenylase PARN, and translation inhibitory factor neuroguidin (Ngd) are components of a dendritic CPEB-associated polyadenylation apparatus
21995630 human CPE-binding protein 1 and hGLD-2 are antagonizing factors regulating p53 mRNA stability.
20144904 The authors show that the human CPEB1 can repress the activity of the reporter construct containing the HPV-16 early sequences. This repression can be counteracted by a human cytoplasmic poly(A) polymerase, hGLD-2 fused to CPEB1.

AA Sequence

MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGNVSPIQTSASP      1 - 70
LFRGRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIA     71 - 140
FLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTR    141 - 210
SSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDL    211 - 280
NVNNIVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHQINDASRGTLSSYSLVLMVLHYLQTLPEPILP    281 - 350
SLQKIYPESFSPAIQLHLVHQAPCNVPPYLSKNESNLGDLLLGFLKYYATEFDWNSQMISVREAKAIPRP    351 - 420
DGIEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWHRLKNKRDLNSILPVRAAVLKR          421 - 484
//

Text Mined References (22)

PMID Year Title
26926106 2016 The STAR protein QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
25416956 2014 A proteome-scale map of the human interactome network.
24667324 2014 HBx down-regulated Gld2 plays a critical role in HBV-related dysregulation of miR-122.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23200856 2012 Specific miRNA stabilization by Gld2-catalyzed monoadenylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063654 2012 Mono-uridylation of pre-microRNA as a key step in the biogenesis of group II let-7 microRNAs.
22727665 2012 Bidirectional control of mRNA translation and synaptic plasticity by the cytoplasmic polyadenylation complex.
21995630 2011 Involvement of hGLD-2 in cytoplasmic polyadenylation of human p53 mRNA.
21813625 2011 Post-transcriptional generation of miRNA variants by multiple nucleotidyl transferases contributes to miRNA transcriptome complexity.
More...