Property Summary

NCBI Gene PubMed Count 17
PubMed Score 33.95
PubTator Score 15.55

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26926106 QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
24667324 HBx is a critical protein derived from HBV, which regulates miR-122 via down-regulating Gld2
23200856 The noncanonical polymerase Gld2 has been implicated in the stabilization of miR-122, possibly through catalyzing 3' monoadenylation
23063654 Study identified TUT7, TUT4, and TUT2 as novel components of the miRNA biogenesis pathway.
22727665 poly(A) polymerase Gld2, deadenylase PARN, and translation inhibitory factor neuroguidin (Ngd) are components of a dendritic CPEB-associated polyadenylation apparatus
21995630 human CPE-binding protein 1 and hGLD-2 are antagonizing factors regulating p53 mRNA stability.
20144904 The authors show that the human CPEB1 can repress the activity of the reporter construct containing the HPV-16 early sequences. This repression can be counteracted by a human cytoplasmic poly(A) polymerase, hGLD-2 fused to CPEB1.

AA Sequence

MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGNVSPIQTSASP      1 - 70
LFRGRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIA     71 - 140
FLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTR    141 - 210
SSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDL    211 - 280
NVNNIVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHQINDASRGTLSSYSLVLMVLHYLQTLPEPILP    281 - 350
SLQKIYPESFSPAIQLHLVHQAPCNVPPYLSKNESNLGDLLLGFLKYYATEFDWNSQMISVREAKAIPRP    351 - 420
DGIEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWHRLKNKRDLNSILPVRAAVLKR          421 - 484
//

Text Mined References (22)

PMID Year Title
26926106 2016 The STAR protein QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
25416956 2014 A proteome-scale map of the human interactome network.
24667324 2014 HBx down-regulated Gld2 plays a critical role in HBV-related dysregulation of miR-122.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23200856 2012 Specific miRNA stabilization by Gld2-catalyzed monoadenylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063654 2012 Mono-uridylation of pre-microRNA as a key step in the biogenesis of group II let-7 microRNAs.
22727665 2012 Bidirectional control of mRNA translation and synaptic plasticity by the cytoplasmic polyadenylation complex.
21995630 2011 Involvement of hGLD-2 in cytoplasmic polyadenylation of human p53 mRNA.
21813625 2011 Post-transcriptional generation of miRNA variants by multiple nucleotidyl transferases contributes to miRNA transcriptome complexity.
21700879 2011 Novel locus FER is associated with serum HMW adiponectin levels.
20144904 2010 The early noncoding region of human papillomavirus type 16 is regulated by cytoplasmic polyadenylation factors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15987818 2005 Vertebrate GLD2 poly(A) polymerases in the germline and the brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15070731 2004 Mammalian GLD-2 homologs are poly(A) polymerases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.