Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.7e-03
ependymoma 1.400 1.5e-04
group 3 medulloblastoma 1.200 3.8e-04
osteosarcoma -3.415 4.9e-07
tuberculosis 1.200 2.2e-04

AA Sequence

MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITY      1 - 70
MTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYK     71 - 140
ELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLR    141 - 210
TAQPIIGTTHPSIVDCVLKVLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKI    211 - 280
LSDPSVLQLTPSLPMFLQQAAAAKAIGVLARNDMSIAEELLYLRVVRGLMAAMGNTDHSNSQRLASLTLE    281 - 350
CFVQMFPLVAEHVRKCMGEELYQLFLSNAEDLYMKIDSIQADILAANTVNVTKALCLHGSSYSMNTLYGS    351 - 420
RDSAQMAYLTHFEEDVESKE                                                      421 - 440
//

Text Mined References (2)

PMID Year Title