Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.672 0.000
posterior fossa group B ependymoma 2.300 0.000
atypical teratoid / rhabdoid tumor 1.100 0.003
tuberculosis 1.200 0.000
group 3 medulloblastoma 1.200 0.000

Synonym

Accession Q6PIY5 A1KXE5
Symbols p40
NCRNA00082

Gene

 Compartment GO Term (0)

AA Sequence

MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITY      1 - 70
MTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYK     71 - 140
ELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLR    141 - 210
TAQPIIGTTHPSIVDCVLKVLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKI    211 - 280
LSDPSVLQLTPSLPMFLQQAAAAKAIGVLARNDMSIAEELLYLRVVRGLMAAMGNTDHSNSQRLASLTLE    281 - 350
CFVQMFPLVAEHVRKCMGEELYQLFLSNAEDLYMKIDSIQADILAANTVNVTKALCLHGSSYSMNTLYGS    351 - 420
RDSAQMAYLTHFEEDVESKE                                                      421 - 440
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.