Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $23,142.29
PubMed Score 7.11
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23754376 RAD51-binding protein fidgetin-like 1 (FIGNL1) is identified; FIGNL1 specifically interacts with RAD51 through its conserved RAD51 binding domain. Cells depleted of FIGNL1 show defective homologous recombination repair.
19058789 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQTSSSRSVHLSEWQKNYFAITSGICTGPKADAYRAQILRIQYAWANSEISQVCATKLFKKYAEKYSAII      1 - 70
DSDNVESGLNNYAENILTLAGSQQTDSDKWQSGLSINNVFKMSSVQKMMQAGKKFKDSLLEPALASVVIH     71 - 140
KEATVFDLPKFSVCGSSQESDSLPNSAHDRDRTQDFPESNRLKLLQNAQPPMVTNTARTCPTFSAPVGES    141 - 210
ATAKFHVTPLFGNVKKENHSSAKENIGLNVFLSNQSCFPAACENPQRKSFYGSGTIDALSNPILNKACSK    211 - 280
TEDNGPKEDSSLPTFKTAKEQLWVDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGG    281 - 350
EQNGGMQCKPYGAGPTEPAHPVDERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWP    351 - 420
MLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVAR    421 - 490
CQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLV    491 - 560
KRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIAT    561 - 630
ITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFGCGK                              631 - 674
//

Text Mined References (20)

PMID Year Title
27384458 2016 Fidgetin-like 1 is a ciliogenesis-inhibitory centrosome protein.
25416956 2014 A proteome-scale map of the human interactome network.
23754376 2013 FIGNL1-containing protein complex is required for efficient homologous recombination repair.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
More...