Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.65
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -2.172 4.0e-03
active ulcerative colitis -1.578 8.2e-03
adrenocortical carcinoma -1.079 7.2e-09
osteosarcoma -1.679 1.3e-05
psoriasis -1.100 3.4e-17

Gene RIF (2)

AA Sequence

METVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAVARADGLWGLQ      1 - 70
KGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGTVVAGAVAGALGAFVGSPAYLIKTQLQAQTVAAVA     71 - 140
VGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATFASAKAWVQKQQWLPEDSWLVAL    141 - 210
AGGMISSIAVVVVMTPFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLGPAYLRLGP    211 - 280
HTILSMLFWDELRKLAGRAQHKGT                                                  281 - 304
//

Text Mined References (8)

PMID Year Title