Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $44,199
PubMed Score 4.16
PubTator Score 4.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.700 0.001
facioscapulohumeral dystrophy 2.200 0.017

Gene RIF (1)

PMID Text
21860421 FOXR1 is recurrently activated in neuroblastoma by intrachromosomal deletion/fusion events, resulting in overexpression of fusion transcripts

AA Sequence

MGNELFLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEV      1 - 70
SGRRKREDLTSTLPSSQPPQKEEDASCSEAAGVESLSQSSSKRSPPRKRFAFSPSTWELTEEEEAEDQED     71 - 140
SSSMALPSPHKRAPLQSRRLRQASSQAGRLWSRPPLNYFHLIALALRNSSPCGLNVQQIYSFTRKHFPFF    141 - 210
RTAPEGWKNTVRHNLCFRDSFEKVPVSMQGGASTRPRSCLWKLTEEGHRRFAEEARALASTRLESIQQCM    211 - 280
SQPDVMPFLFDL                                                              281 - 292
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21860421 2012 Oncogenic activation of FOXR1 by 11q23 intrachromosomal deletion-fusions in neuroblastoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15492844 2004 Human FOX gene family (Review).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15067358 2004 Identification and characterization of human FOXN5 and rat Foxn5 genes in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.