Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.36
PubTator Score 4.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 9.1e-04
facioscapulohumeral dystrophy 288 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Retinitis pigmentosa 23 27 4.092 2.0
Neuroblastoma 80 3.071 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 2.200 1.7e-02
psoriasis -1.700 9.1e-04

Gene RIF (1)

AA Sequence

MGNELFLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEV      1 - 70
SGRRKREDLTSTLPSSQPPQKEEDASCSEAAGVESLSQSSSKRSPPRKRFAFSPSTWELTEEEEAEDQED     71 - 140
SSSMALPSPHKRAPLQSRRLRQASSQAGRLWSRPPLNYFHLIALALRNSSPCGLNVQQIYSFTRKHFPFF    141 - 210
RTAPEGWKNTVRHNLCFRDSFEKVPVSMQGGASTRPRSCLWKLTEEGHRRFAEEARALASTRLESIQQCM    211 - 280
SQPDVMPFLFDL                                                              281 - 292
//

Text Mined References (7)

PMID Year Title