Property Summary

Ligand Count 14
NCBI Gene PubMed Count 18
PubMed Score 43.57
PubTator Score 17.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Gene RIF (13)

AA Sequence

MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFG      1 - 70
KKSAWSSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNA     71 - 140
VIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASL    141 - 210
KNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAA    211 - 280
AVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVL    281 - 350
RDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL                351 - 408
//

Text Mined References (24)

PMID Year Title