Property Summary

Ligand Count 3
NCBI Gene PubMed Count 9
PubMed Score 5.75
PubTator Score 7.42

Knowledge Summary

Patent (970)

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis -1.146 3.5e-02
adult high grade glioma -2.600 2.3e-02
astrocytic glioma -2.800 4.5e-04
Astrocytoma, Pilocytic -1.700 1.0e-03
atypical teratoid / rhabdoid tumor -2.400 4.8e-08
ependymoma -3.000 4.9e-04
glioblastoma -1.500 6.7e-05
group 3 medulloblastoma -3.200 3.8e-02
malignant mesothelioma 1.300 9.4e-05
medulloblastoma, large-cell -2.200 3.2e-03
oligodendroglioma -1.100 3.9e-02
Pick disease -1.200 3.9e-02
primitive neuroectodermal tumor -2.600 1.5e-04
psoriasis -2.000 1.1e-17

AA Sequence

MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAV      1 - 70
VVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTGRLHVMEQLCALSFLQEIQYW     71 - 140
GIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHESEQDFSQGPCPTVRQKLWNILEKPGSSTAAR    141 - 210
IFGVISIIFVVVSIINMALMSAELSWLDLQLLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDL    211 - 280
LAILPFYITLLVESLSGSQTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLL    281 - 350
LFLSVGISIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL    351 - 420
ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEMLRLKGRERAST    421 - 490
RSSGGDDFWF                                                                491 - 500
//

Text Mined References (10)

PMID Year Title