Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.75
PubTator Score 7.42

Knowledge Summary

Patent (970)

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
astrocytic glioma -2.800 0.000
ependymoma -3.000 0.000
oligodendroglioma -2.800 0.001
glioblastoma -3.700 0.000
medulloblastoma -3.900 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -3.700 0.002
primitive neuroectodermal tumor -3.900 0.000
active ulcerative colitis -1.146 0.035
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -3.100 0.000
Pick disease -1.200 0.039
psoriasis -2.000 0.000

Synonym

Accession Q6PIU1 Q9UHJ4
Symbols HNKA
KCNB3
KV2.3
KV8.1

Gene

AA Sequence

MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAV      1 - 70
VVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTGRLHVMEQLCALSFLQEIQYW     71 - 140
GIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHESEQDFSQGPCPTVRQKLWNILEKPGSSTAAR    141 - 210
IFGVISIIFVVVSIINMALMSAELSWLDLQLLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDL    211 - 280
LAILPFYITLLVESLSGSQTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLL    281 - 350
LFLSVGISIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL    351 - 420
ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEMLRLKGRERAST    421 - 490
RSSGGDDFWF                                                                491 - 500
//

Text Mined References (10)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14697513 2004 Structural characterization and promoter analysis of human potassium channel Kv8.1 (KCNV1) gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383276 2002 Positional candidate approach for the gene responsible for benign adult familial myoclonic epilepsy.
9110174 1997 Large-scale concatenation cDNA sequencing.
9079713 1997 Modes of regulation of shab K+ channel activity by the Kv8.1 subunit.
8670833 1996 Kv8.1, a new neuronal potassium channel subunit with specific inhibitory properties towards Shab and Shaw channels.
8619474 1996 A "double adaptor" method for improved shotgun library construction.