Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.35
PubTator Score 2.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.085 0.007
medulloblastoma, large-cell 1.700 0.000
active Crohn's disease -1.899 0.012
active ulcerative colitis -1.663 0.020
adult high grade glioma 1.100 0.002
ovarian cancer 1.100 0.000

Gene RIF (1)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRSPLNPSQLRSVGSQDALAPLPPPAPQNPSTHSWDPLCGSLPWGLSCLLALQHVLVMASLLCVSHLLL      1 - 70
LCSLSPGGLSYSPSQLLASSFFSCGMSTILQTWMGSRLPLVQAPSLEFLIPALVLTSQKLPRAIQTPGNS     71 - 140
SLMLHLCRGPSCHGLGHWNTSLQEVSGAVVVSGLLQGMMGLLGSPGHVFPHCGPLVLAPSLVVAGLSAHR    141 - 210
EVAQFCFTHWGLALLVILLMVVCSQHLGSCQFHVCPWRRASTSSTHTPLPVFRLLSVLIPVACVWIVSAF    211 - 280
VGFSVIPQELSAPTKAPWIWLPHPGEWNWPLLTPRALAAGISMALAASTSSLGCYALCGRLLHLPPPPPH    281 - 350
ACSRGLSLEGLGSVLAGLLGSPMGTASSFPNVGKVGLIQAGSQQVAHLVGLLCVGLGLSPRLAQLLTTIP    351 - 420
LPVVGGVLGVTQAVVLSAGFSSFYLADIDSGRNIFIVGFSIFMALLLPRWFREAPVLFSTGWSPLDVLLH    421 - 490
SLLTQPIFLAGLSGFLLENTIPGTQLERGLGQGLPSPFTAQEARMPQKPREKAAQVYRLPFPIQNLCPCI    491 - 560
PQPLHCLCPLPEDPGDEEGGSSEPEEMADLLPGSGEPCPESSREGFRSQK                        561 - 610
//

Text Mined References (9)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
7588067 1995 A new approach to the study of haematopoietic development in the yolk sac and embryoid bodies.