Property Summary

NCBI Gene PubMed Count 27
PubMed Score 48.40
PubTator Score 21.98

Knowledge Summary

Patent (2,767)


  Disease Sources (4)

Disease Target Count
Parkinson Disease 105
Disease Target Count P-value
ependymoma 2514 6.63419510303997E-16
atypical teratoid / rhabdoid tumor 4369 2.25381168061843E-13
lung carcinoma 2844 5.05687120190262E-12
pediatric high grade glioma 2712 1.12135052958442E-6
glioblastoma 5572 2.50821178733871E-6
primitive neuroectodermal tumor 3031 6.26101116111805E-6
medulloblastoma, large-cell 6234 9.95570584813929E-6
ovarian cancer 8492 4.44928369717938E-5
sonic hedgehog group medulloblastoma 1482 4.87979994740753E-5
pilocytic astrocytoma 3086 3.00912931669553E-4
Pick disease 1893 0.00121040746891335
astrocytic glioma 2241 0.00438524940007724
oligodendroglioma 2849 0.0111183790098806
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0
Disease Target Count Z-score Confidence
Leiomyosarcoma 19 3.366 1.7
epithelial-myoepithelial carcinoma 4 3.185 1.6


  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.700 0.004
ependymoma -3.500 0.000
oligodendroglioma -2.700 0.011
glioblastoma -4.300 0.000
sonic hedgehog group medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -3.900 0.000
pediatric high grade glioma -3.300 0.000
pilocytic astrocytoma -1.500 0.000
lung carcinoma 2.100 0.000
Pick disease -1.200 0.001
ovarian cancer -1.100 0.000



  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (18)

24811166 Subunit counting by single-molecule imaging revealed that the bound number of KChIP4 in each Kv4.2.KChIP4 complex was dependent on the expression level of KChIP4.
23576435 KChIP4a suppresses A-type Kv4 current via ER retention and enhancement of Kv4 closed-state inactivation.
23457522 Genome-wide association study identifies KCNIP4 as an asthma gene in human and in mouse.
22981920 genetic association studies in populations in Germany: Data suggest that multiple SNPs in KCNIP4 are associated not only with attention deficit disorder with hyperactivity in children and adults but also with personality disorders.
21624954 The synthesis of the variant KCNIP4 isoform is also detrimental to brain physiology, as it results in the concomitant blockade of the fast kinetics of potassium channels.
20877300 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20045463 These data demonstrate that PKA phosphorylation of Kv4.2 plays an important role in the trafficking of Kv4.2 through its specific interaction with KChIP4a.
19910543 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI                                  211 - 250

Text Mined References (28)

PMID Year Title
24811166 2014 The stoichiometry and biophysical properties of the Kv4 potassium channel complex with K+ channel-interacting protein (KChIP) subunits are variable, depending on the relative expression level.
23576435 2013 Auxiliary KChIP4a suppresses A-type K+ current through endoplasmic reticulum (ER) retention and promoting closed-state inactivation of Kv4 channels.
23457522 2013 Integration of mouse and human genome-wide association data identifies KCNIP4 as an asthma gene.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22981920 2013 KCNIP4 as a candidate gene for personality disorders and adult ADHD.
21624954 2011 RNA polymerase III drives alternative splicing of the potassium channel-interacting protein contributing to brain complexity and neurodegeneration.
21156761 2011 A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.
20877300 2012 Genome-wide association study of increasing suicidal ideation during antidepressant treatment in the GENDEP project.
20670164 2010 Association of genetic polymorphisms with hepatotoxicity in patients with childhood acute lymphoblastic leukemia or lymphoma.