Property Summary

NCBI Gene PubMed Count 29
PubMed Score 49.37
PubTator Score 21.98

Knowledge Summary

Patent (2,767)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.500 8.3e-03
astrocytic glioma -2.100 9.1e-03
Astrocytoma, Pilocytic -1.100 1.2e-02
atypical teratoid / rhabdoid tumor -2.500 9.6e-11
ependymoma -2.700 1.4e-03
glioblastoma -2.000 2.0e-07
lung carcinoma 2.100 5.1e-12
medulloblastoma -1.800 1.3e-02
medulloblastoma, large-cell -1.400 2.1e-03
oligodendroglioma -2.500 5.3e-03
ovarian cancer -1.100 4.4e-05
Pick disease -1.200 1.2e-03
primitive neuroectodermal tumor -2.200 1.2e-04

Protein-protein Interaction (6)

Gene RIF (19)

AA Sequence

MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP      1 - 70
EALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAV     71 - 140
SFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVE    141 - 210
TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI                                  211 - 250
//

Text Mined References (30)

PMID Year Title