Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.71
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
HYPOTONIA, INFANTILE, WITH PSYCHOMOTOR RETARDATION 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 7.3e-07
group 3 medulloblastoma 4104 9.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Skull base meningioma 3 4.915 2.5
Panhypopituitarism 14 3.415 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 9.8e-04
osteosarcoma -1.870 7.3e-07

Synonym

Accession Q6PII3 Q96CS5
Symbols IHPM
IHPMR
C3orf19
HSPC212

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDRRKKPLDVTASSLVDLKAELFRKQEEFKQEKLLKDSGVFGKPKTTNKKPSIWSKQNVGVSNRAEKDAE      1 - 70
QKIEEQKTLDKAREKLEEKAKLYEKMTKGDFIDEEVEDMYLVDFTQKIIDKRKEMEASGAHRDSQKAGER     71 - 140
DDDEENLPEGEIPPPQDPSEEWVDYVDSLGRSRRCMRKDLPDLLEMDKNLQGRLFISPANEKTLLSEDMR    141 - 210
KELQRQQWEEEEREALKRPMGPVHYEDIRENEARQLGVGYFAFARDKELRNKQMKTLEMLREQTTDQRTK    211 - 280
RENIKEKRKAILEARLAKLRQKKMKKSKEGGTEEENRDGDVIGPLPPEPEAVPTPRPAAQSSKVEVIVQE    281 - 350
RKDTKPGVPHIREWDRGKEFSFGYWSKRQSDLRAERDPEFAPPSDYFVGQKRTGFSSSQAWSRPGPAQSD    351 - 420
PGQCPDQSHGPSPEHTSPTPAPDNPPQAPTVTFKTLDDMISYYKQVT                           421 - 467
//

Text Mined References (11)

PMID Year Title