Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.92
PubTator Score 3.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.300 0.033
osteosarcoma -2.280 0.000
group 4 medulloblastoma 1.200 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q6PIF2 B4DYD3
Symbols CESC1

Gene

Gene RIF (3)

PMID Text
22870393 a model of chromosome synapsis driven by growth of SYCE2-TEX12 higher-order structures within the CE of the SC.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDIL      1 - 70
QKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKIS     71 - 140
HLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEV    141 - 210
QTNRDGEC                                                                  211 - 218
//

Text Mined References (12)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22870393 2012 Structural analysis of the human SYCE2-TEX12 complex provides molecular insights into synaptonemal complex assembly.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17339376 2007 SYCE2 is required for synaptonemal complex assembly, double strand break repair, and homologous recombination.
15944401 2005 Two novel proteins recruited by synaptonemal complex protein 1 (SYCP1) are at the centre of meiosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...