Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.70
PubTator Score 5.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.100 4.8e-05
glioblastoma 1.300 5.0e-03
lung cancer 1.700 4.1e-03
medulloblastoma, large-cell 1.100 7.7e-03
osteosarcoma 1.282 1.2e-04
ovarian cancer -1.100 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.247 4.6e-02
psoriasis 1.300 5.2e-03
Waldenstrons macroglobulinemia 1.022 2.0e-02

Gene RIF (1)

AA Sequence

MSAAQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPGKKKIRWDPVRRRFI      1 - 70
QSCPIIRIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGPDNEDYPLFRELWRYHFATGV     71 - 140
WHQMGTDGYMPRELASMSLVLHGNNLLVFGGTGIPFGESNGNDVHVCNVKYKRWALLSCRGKKPSRIYGQ    141 - 210
AMAIINGSLYVFGGTTGYIYSTDLHKLDLNTREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTS    211 - 280
WTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQT    281 - 350
FQWVKLPATMPEPVYFHCAAVTPAGCMYIHGGVVNIHENKRTGSLFKIWLVVPSLLELAWEKLLAAFPNL    351 - 420
ANLSRTQLLHLGLTQGLIERLK                                                    421 - 442
//

Text Mined References (8)

PMID Year Title