Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
R01 Count 1
Funding $75,547.67
PubMed Score 0.00
PubTator Score 5.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.200 0.001
group 3 medulloblastoma 1.100 0.011
lung adenocarcinoma -1.200 0.000
spina bifida -1.477 0.035
ovarian cancer -2.300 0.000

Synonym

Accession Q6PI98 B4DUI4 E9PCS7 Q86WR1 Q8N994
Symbols IES6
hIes6
C18orf37

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
16230350 C18orf37, similar in sequence to yeast Ies6p. A subunit of the Ino80 chromatin remodeling complex, which has roles in transcription and DNA repair.

AA Sequence

MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMSENKMVPSEFS      1 - 70
TGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAK     71 - 140
KYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP                      141 - 192
//

Text Mined References (11)

PMID Year Title
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...