Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 5.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.1e-02
intraductal papillary-mucinous adenoma (... 1.200 1.1e-03
lung adenocarcinoma -1.200 6.8e-11
ovarian cancer -2.300 1.7e-08
spina bifida -1.477 3.5e-02

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMSENKMVPSEFS      1 - 70
TGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAK     71 - 140
KYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP                      141 - 192
//

Text Mined References (12)

PMID Year Title