Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 8.37612807721937E-16
nasopharyngeal carcinoma 1056 1.16157641418066E-8
lung adenocarcinoma 2714 3.62614214177788E-4
lung carcinoma 2844 4.93588847216945E-4
Endometriosis 535 0.0114232584166411

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 4.800 0.000
lung adenocarcinoma -1.100 0.000
nasopharyngeal carcinoma -2.100 0.000
Endometriosis -1.368 0.011
lung carcinoma -1.400 0.000

AA Sequence

METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPR      1 - 70
RSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKAKTREEILQLLRKQREERISKELISLP     71 - 140
YKPKAKEHKAKKVVSESDKEDQEEVKTLD                                             141 - 169
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.