Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 5.8e-10
nasopharyngeal carcinoma 1058 1.2e-08
lung adenocarcinoma 2716 3.6e-04
lung carcinoma 2843 4.9e-04
Endometriosis 540 1.1e-02

Expression

  Differential Expression (5)

Disease log2 FC p
Endometriosis -1.368 1.1e-02
ependymoma 3.200 5.8e-10
lung adenocarcinoma -1.100 3.6e-04
lung carcinoma -1.400 4.9e-04
nasopharyngeal carcinoma -2.100 1.2e-08

AA Sequence

METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPR      1 - 70
RSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKAKTREEILQLLRKQREERISKELISLP     71 - 140
YKPKAKEHKAKKVVSESDKEDQEEVKTLD                                             141 - 169
//

Text Mined References (4)

PMID Year Title