Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.43
PubTator Score 1.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRLLPLLRSRTARSLRPGPAAAAAPRPPSWCCCGRGLLALAPPGGLPGGPRRLGTHPKKEPMEALNTAQ      1 - 70
GARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPTPGQLRYVFIHNAIPFIGFGFLDNAIMIVAG     71 - 140
THIEMSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKA    141 - 210
VGVTIGCILGMFPLIFFGGGEEDEKLETKS                                            211 - 240
//

Text Mined References (9)

PMID Year Title
26403541 2015 Evolutionarily conserved intercalated disc protein Tmem65 regulates cardiac conduction and connexin 43 function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24765583 2014 TMEM65 is a mitochondrial inner-membrane protein.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.