Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.43
PubTator Score 1.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.098 6.3e-03
active ulcerative colitis -1.250 1.2e-02
adrenocortical carcinoma 1.094 1.5e-02
adult high grade glioma -2.000 1.1e-05
Astrocytoma, Pilocytic -1.400 5.6e-05
atypical teratoid / rhabdoid tumor -1.100 1.8e-03
Breast cancer 2.600 4.7e-02
cystic fibrosis -1.200 1.3e-03
ependymoma -1.300 2.1e-04
glioblastoma -1.400 4.5e-05
group 4 medulloblastoma -1.400 4.0e-04
intraductal papillary-mucinous adenoma (... -1.800 2.8e-03
invasive ductal carcinoma 1.300 1.4e-02
medulloblastoma, large-cell -1.700 7.2e-04
osteosarcoma 1.880 1.2e-04
ovarian cancer 1.900 1.5e-04
primitive neuroectodermal tumor -1.100 2.0e-02
tuberculosis 1.200 3.4e-07

Gene RIF (2)

AA Sequence

MSRLLPLLRSRTARSLRPGPAAAAAPRPPSWCCCGRGLLALAPPGGLPGGPRRLGTHPKKEPMEALNTAQ      1 - 70
GARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPTPGQLRYVFIHNAIPFIGFGFLDNAIMIVAG     71 - 140
THIEMSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKA    141 - 210
VGVTIGCILGMFPLIFFGGGEEDEKLETKS                                            211 - 240
//

Text Mined References (11)

PMID Year Title