Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.43
PubTator Score 1.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis and treatment for 3 months 327 4.34321575292957E-7
group 4 medulloblastoma 1875 2.22433319747664E-6
atypical teratoid / rhabdoid tumor 4369 9.29089605122771E-6
adult high grade glioma 2148 1.05743612209372E-5
glioblastoma 5572 4.29440875395329E-5
pilocytic astrocytoma 3086 6.02089226825704E-5
ulcerative colitis 2087 6.37389534548846E-5
osteosarcoma 7933 1.16248419133315E-4
ovarian cancer 8492 1.51588434144258E-4
ependymoma 2514 2.10627930959493E-4
medulloblastoma, large-cell 6234 4.61017927938719E-4
cystic fibrosis 1670 0.00129887207783904
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00280215382959723
active Crohn's disease 918 0.00628953091926714
invasive ductal carcinoma 2950 0.0141745425992944
adrenocortical carcinoma 1427 0.0152337447736822
primitive neuroectodermal tumor 3031 0.0351068868421346
Breast cancer 3099 0.0474825220078752

Expression

  Differential Expression (18)

Synonym

Accession Q6PI78 Q8N5G8 Q8WVK5
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRLLPLLRSRTARSLRPGPAAAAAPRPPSWCCCGRGLLALAPPGGLPGGPRRLGTHPKKEPMEALNTAQ      1 - 70
GARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPTPGQLRYVFIHNAIPFIGFGFLDNAIMIVAG     71 - 140
THIEMSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKA    141 - 210
VGVTIGCILGMFPLIFFGGGEEDEKLETKS                                            211 - 240
//

Text Mined References (9)

PMID Year Title
26403541 2015 Evolutionarily conserved intercalated disc protein Tmem65 regulates cardiac conduction and connexin 43 function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24765583 2014 TMEM65 is a mitochondrial inner-membrane protein.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.