Property Summary

NCBI Gene PubMed Count 10
PubMed Score 21.94
PubTator Score 9.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 4.0e-20
mucosa-associated lymphoid tissue lymphoma 484 6.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Takayasu's arteritis 53 4.051 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.600 4.0e-20
mucosa-associated lymphoid tissue lympho... 1.470 6.4e-03

Gene RIF (4)

AA Sequence

MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLD      1 - 70
RNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNM     71 - 140
TLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHP    141 - 210
SDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQAN    211 - 280
FTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGY    281 - 350
FDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSG    351 - 420
HSGGSSLPPTGPPSTPASHAKDYTVENLIRMGMAGLVLVFLGILLFEAQHSQRNPQDAAGR             421 - 481
//

Text Mined References (10)

PMID Year Title