Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
R01 Count 1
Funding $235,360
PubMed Score 22.37
PubTator Score 9.01

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.600 0.000
mucosa-associated lymphoid tissue lympho... 1.470 0.006

Gene RIF (3)

PMID Text
24096970 LILRA6 copy number variation may influence the level of the activating receptor on the cell surface, potentially affecting signaling upon LILRB3/A6 ligation
20331378 Observational study of gene-disease association. (HuGE Navigator)
19617579 Allogeneic disparities in immunoglobulin-like transcript 5 induce potent antibody responses in hematopoietic stem cell transplant recipients

AA Sequence

MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLD      1 - 70
RNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNM     71 - 140
TLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHP    141 - 210
SDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQAN    211 - 280
FTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGY    281 - 350
FDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSG    351 - 420
HSGGSSLPPTGPPSTPASHAKDYTVENLIRMGMAGLVLVFLGILLFEAQHSQRNPQDAAGR             421 - 481
//

Text Mined References (9)

PMID Year Title
24096970 2014 Diversity of the human LILRB3/A6 locus encoding a myeloid inhibitory and activating receptor pair.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19617579 2009 Allogeneic disparities in immunoglobulin-like transcript 5 induce potent antibody responses in hematopoietic stem cell transplant recipients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10941842 2000 Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.