Property Summary

NCBI Gene PubMed Count 23
PubMed Score 45.52
PubTator Score 68.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
non-small cell lung cancer 2890 5.7e-17
ovarian cancer 8520 6.1e-09
malignant mesothelioma 3232 2.3e-06
medulloblastoma, large-cell 6241 1.6e-04
lung cancer 4740 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 2.100 1.2e-02
malignant mesothelioma 1.100 2.3e-06
medulloblastoma, large-cell 1.400 1.6e-04
non-small cell lung cancer 1.254 5.7e-17
ovarian cancer 1.200 6.1e-09

Gene RIF (16)

AA Sequence

MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCG      1 - 70
WIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIE     71 - 140
IKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDI    141 - 210
ETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQ    211 - 280
IDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRN    281 - 350
TEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIME    351 - 420
SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPK    421 - 490
EENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKED    491 - 560
VKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH    561 - 630
IRVSKPTDSKAERAH                                                           631 - 645
//

Text Mined References (26)

PMID Year Title