Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.67
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.9e-07
posterior fossa group A ependymoma 468 4.9e-06
aldosterone-producing adenoma 665 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Restless legs syndrome 27 3.816 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma -1.161 2.7e-02
osteosarcoma 1.244 7.9e-07
posterior fossa group A ependymoma 1.100 4.9e-06

Synonym

Accession Q6PI47 Q53T21 Q6NW26 Q6PCD8 Q8N9B7 Q96N73
Symbols 6530404F10Rik

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MEGHKAEEEVLDVLRLNVGGCIYTARRESLCRFKDSMLASMFSGRFPLKTDESGACVIDRDGRLFKYLLD      1 - 70
YLHGEVQIPTDEQTRIALQEEADYFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKP     71 - 140
TVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNNVQYIWSYYSVAELKKM    141 - 210
MDAFDAWEGKGVSYWRVPHELIECWTLEERPLLGSLRHMAPIRKRRLITFNEADESVNYKTGPKPVRFLG    211 - 280
PSTSTQIKVKNSASVTVSPASAIQTSAGATANRFQSGSRRKAAQRSAPSRATALVGTGAPGHPQASPGAA    281 - 350
SAENGGTHLPPAKVLLSDKKPTPQRVIKLKRTPLCATAPCLPSPTATRQANSLKPLPGEAARALGVRTEN    351 - 420
GKNKGN                                                                    421 - 426
//

Text Mined References (6)

PMID Year Title