Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.10
PubTator Score 7.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Dyskeratosis congenita 24 5.125 2.6

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 1.6e-03
group 3 medulloblastoma 1.500 1.6e-04
osteosarcoma -1.162 4.0e-04
ovarian cancer -1.500 2.6e-05
pancreatic cancer 1.100 2.2e-03
pancreatic carcinoma 1.100 2.2e-03
Waldenstrons macroglobulinemia 1.309 1.9e-03

Synonym

Accession Q6PI26 B4DL05 Q6MZJ4 Q7Z748 Q9H7E5 Q9NVS8
Symbols Shq1p
GRIM-1

Gene

PDB

2MNW   4PBD   4PCK  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKG      1 - 70
IFTIRLPKETPGQHFEGLNMLTALLAPRKSRTAKPLVEEIGASEIPEEVVDDEEFDWEIEQTPCEEVSES     71 - 140
ALNPQCHYGFGNLRSGVLQRLQDELSDVIDIKDPDFTPAAERRQKRLAAELAKFDPDHYLADFFEDEAIE    141 - 210
QILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKFVNKSYLLDKRACRQVCYSLIDILL    211 - 280
AYCYETRVTEGEKNVESAWNIRKLSPTLCWFETWTNVHDIMVSFGRRVLCYPLYRHFKLVMKAYRDTIKI    281 - 350
LQLGKSAVLKCLLDIHKIFQENDPAYILNDLYISDYCVWIQKVKSKKLAALAEALKEVSLTKAQLGLELE    351 - 420
ELEAAALLVQEEETALKAAHSVSGQQTLCSSSEASDSEDSDSSVSSGNEDSGSDSEQDELKDSPSETVSS    421 - 490
LQGPFLEESSAFLIVDGGVRRNTAIQESDASQGKPLASSWPLGVSGPLIEELGEQLKTTVQVSEPKGTTA    491 - 560
VNRSNIQERDGCQTPNN                                                         561 - 577
//

Text Mined References (13)

PMID Year Title