Property Summary

NCBI Gene PubMed Count 10
Grant Count 9
R01 Count 9
Funding $619,263.25
PubMed Score 11.24
PubTator Score 7.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 0.002
pancreatic cancer 1.100 0.002
Waldenstrons macroglobulinemia 1.309 0.002
osteosarcoma -2.358 0.000
group 3 medulloblastoma 1.500 0.000
pancreatic carcinoma 1.100 0.002
ovarian cancer 1.700 0.000

Gene RIF (3)

PMID Text
25553844 these results provide insight into the Shq1/dyskerin (Cbf5) interaction that plays a critical role in H/ACA RNP biogenesis and assembly in eukaryotes
25081541 The expression of GRIM-1 and GRP78 was negatively correlated in human non-small cell lung cancer (NSCLC) tissues, and the down-regulation of GRP78 by GRIM-1 provides a possible mechanism for their interaction.
21931644 study suggests that GRIM-1 (SHQ1) might act as a co-tumor suppressor in the prostate

AA Sequence

MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKG      1 - 70
IFTIRLPKETPGQHFEGLNMLTALLAPRKSRTAKPLVEEIGASEIPEEVVDDEEFDWEIEQTPCEEVSES     71 - 140
ALNPQCHYGFGNLRSGVLQRLQDELSDVIDIKDPDFTPAAERRQKRLAAELAKFDPDHYLADFFEDEAIE    141 - 210
QILKYNPWWTDKYSKMMAFLEKSQEQENHATLVSFSEEEKYQLRKFVNKSYLLDKRACRQVCYSLIDILL    211 - 280
AYCYETRVTEGEKNVESAWNIRKLSPTLCWFETWTNVHDIMVSFGRRVLCYPLYRHFKLVMKAYRDTIKI    281 - 350
LQLGKSAVLKCLLDIHKIFQENDPAYILNDLYISDYCVWIQKVKSKKLAALAEALKEVSLTKAQLGLELE    351 - 420
ELEAAALLVQEEETALKAAHSVSGQQTLCSSSEASDSEDSDSSVSSGNEDSGSDSEQDELKDSPSETVSS    421 - 490
LQGPFLEESSAFLIVDGGVRRNTAIQESDASQGKPLASSWPLGVSGPLIEELGEQLKTTVQVSEPKGTTA    491 - 560
VNRSNIQERDGCQTPNN                                                         561 - 577
//

Text Mined References (13)

PMID Year Title
25553844 2015 Structure and interactions of the CS domain of human H/ACA RNP assembly protein Shq1.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
25081541 2014 Reversed expression of GRIM-1 and GRP78 in human non-small cell lung cancer.
21931644 2011 GRIM-1, a novel growth suppressor, inhibits rRNA maturation by suppressing small nucleolar RNAs.
20663920 2010 Identification and characterization of GRIM-1, a cell-death-associated gene product.
19383767 2009 SHQ1 is required prior to NAF1 for assembly of H/ACA small nucleolar and telomerase RNPs.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...