Property Summary

NCBI Gene PubMed Count 21
Grant Count 8
R01 Count 5
Funding $1,937,169.5
PubMed Score 28.90
PubTator Score 28.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26151430 The rate-limiting processes that contribute to the ability of flavin to promote reductive dehalogenation in human IYD.
25395621 A switch between one- and two-electron chemistry of iodotyrosine deiodinase is controlled by substrate.
22535972 Iodotyrosine deiodinase defect identified via genome-wide approach.
21870604 high activity of human saliva peroxidase with iodide as a substrate may play a crucial role in the bioavailability and metabolism of biologically active iodide.
20298747 Mutations in DEHAL1 leads to hypothyroidism, goiter and mental retardation (Review)
18765512 This study describes a functional mutation within IYD, demonstrating the molecular basis of the iodine wasting form of congenital hypothyroidism
18434651 homozygous mutations in DEHAL1 appear to cause human iodotyrosine deiodinase deficiency, leading to hereditary hypothyroidism and goiter
17322488 Diffuse cytoplasmatic localisation or downregulation of DEHAL1 expression in thyroid cancers suggests alteration or loss of DEHAL1 function during thyroid cell dedifferentiation.
16910871 the cytoplasmic tail of DEHAL1 could play a role in the stability of the protein
15289438 molecular cloning and investigation of the localization and activity of DEHAL1

AA Sequence

MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEEN      1 - 70
VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVV     71 - 140
KDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVH    141 - 210
YYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRK    211 - 280
PLDQIMVTV                                                                 281 - 289
//

Text Mined References (22)

PMID Year Title
26151430 2015 Rapid kinetics of dehalogenation promoted by iodotyrosine deiodinase from human thyroid.
25416956 2014 A proteome-scale map of the human interactome network.
25395621 2015 A switch between one- and two-electron chemistry of the human flavoprotein iodotyrosine deiodinase is controlled by substrate.
24489884 2014 Genome-wide association study of proneness to anger.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22535972 2012 Iodotyrosine deiodinase defect identified via genome-wide approach.
21870604 [Biochemical characteristics of iodperoxidase activity of human saliva].
20298747 2010 Genetics and phenomics of hypothyroidism and goiter due to iodotyrosine deiodinase (DEHAL1) gene mutations.
19436071 2009 Crystal structure of iodotyrosine deiodinase, a novel flavoprotein responsible for iodide salvage in thyroid glands.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
More...