Property Summary

NCBI Gene PubMed Count 22
PubMed Score 31.27
PubTator Score 28.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (10)

AA Sequence

MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEEN      1 - 70
VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVV     71 - 140
KDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVH    141 - 210
YYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRK    211 - 280
PLDQIMVTV                                                                 281 - 289
//

Text Mined References (23)

PMID Year Title