Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 7
Funding $421,052
PubMed Score 7.26
PubTator Score 7.28

Knowledge Summary

Patent (1,855)

Expression

Gene RIF (9)

PMID Text
26011858 Structural and biochemical studies reveal an unusually tight interaction between ULK3 and IST1, an ESCRT-III subunit required for cytokinetic abscission.
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20959405 Observational study of gene-disease association. (HuGE Navigator)
20643644 Dual function of UNC-51-like kinase 3 (Ulk3) in the Sonic hedgehog signaling pathway.
20479155 Observational study of gene-disease association. (HuGE Navigator)
19878745 serine/threonine kinase ULK3 is involved in the SHH pathway as a positive regulator of GLI proteins
19430479 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
12471243 First named and identified as protein kinase of the ULK family

AA Sequence

MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLTEIEILKGIR      1 - 70
HPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKP     71 - 140
QNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYEALFGQ    141 - 210
PPFASRSFSELEEKIRSNRVIELPLRPLLSRDCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPSGES    211 - 280
LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSS    281 - 350
SNQALLRQGTSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPG    351 - 420
RRRELLHTEVQNLMARAEYLKEQVKMRESRWEADTLDKEGLSESVRSSCTLQ                      421 - 472
//

Text Mined References (21)

PMID Year Title
26011858 2015 ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
21269460 2011 Initial characterization of the human central proteome.
21045733 2011 Discovery and replication of novel blood pressure genetic loci in the Women's Genome Health Study.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20643644 2010 Dual function of UNC-51-like kinase 3 (Ulk3) in the Sonic hedgehog signaling pathway.
20479155 2010 Blood pressure and hypertension are associated with 7 loci in the Japanese population.
More...