Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.58
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.300 5.2e-04
intraductal papillary-mucinous adenoma (... 1.200 2.3e-03
malignant mesothelioma 1.300 2.2e-06
osteosarcoma -1.243 1.6e-04
pediatric high grade glioma -1.100 3.2e-04
subependymal giant cell astrocytoma -1.215 2.6e-02

AA Sequence

MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYG      1 - 70
RYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKAL     71 - 140
LPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPR    141 - 210
DTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF                         211 - 259
//

Text Mined References (8)

PMID Year Title