Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.58
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.21770882359742E-6
osteosarcoma 7933 1.5898927894086E-4
pediatric high grade glioma 2712 3.15215616497763E-4
glioblastoma 5572 5.18778320652567E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00233711997356382
subependymal giant cell astrocytoma 2287 0.0259211271512345

Expression

  Differential Expression (6)

Synonym

Accession Q6PH85 Q5JSA5 Q5JSA6 Q5JSA7 Q9NVJ1 Q9NXR6
Symbols C13orf17

Gene

PDB

4GAO  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

AA Sequence

MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYG      1 - 70
RYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKAL     71 - 140
LPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPR    141 - 210
DTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF                         211 - 259
//

Text Mined References (8)

PMID Year Title
23201271 2013 Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15988528 2005 The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.