Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 2010 4.5e-05
hepatocellular carcinoma 547 1.8e-04
acute myeloid leukemia 783 3.9e-02

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 3.000 3.9e-02
hepatocellular carcinoma -1.100 1.8e-04
tuberculosis 1.500 4.5e-05

 Compartment GO Term (2)

AA Sequence

MSATRAKKVKMATKSCPECDQQVPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEAKRRRTERVRR      1 - 70
EKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSASAKKHEEEREKQEKEIDIYANLSDEKAFVFSVAL     71 - 140
AEINRKIINQRLIL                                                            141 - 154
//

Text Mined References (7)

PMID Year Title