Property Summary

NCBI Gene PubMed Count 16
PubMed Score 129.80
PubTator Score 13.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25742493 Bora was found to play a significant role in radiosensitivity through the regulation of MDC1 and DNA repair.
24338364 Activation of Plk1 by Aurora-A may function as a bistable switch
23970419 Pin1 acts as a negative regulator of the G2/M transition by interacting with the Aurora-A-Bora complex.
23592782 Following UV irradiation, ataxia telangiectasia-mutated- and Rad3-related protein phosphorylates Bora at Thr-501. The phosphorylated Thr-501 is subsequently recognized by the E3 ubiquitin ligase SCF-beta-TRCP, which targets Bora for degradation.
20923822 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19487276 Recent advances in the understanding of the functional crosstalk between Plk1 and Aurora-A before and during mitosis.
18566290 study reports that the synergistic action of Bora & the kinase Aurora A controls G2-M transition; Bora accumulates in G2 phase & promotes Aur-A-mediated activation of Polo-like kinase 1, leading to activation of cyclin-dependent kinase 1 & mitotic entry
18521620 Plk1 controls Aurora A localization and function by regulating cellular levels of hBora.
18378770 Study concludes that tight regulation of the Bora protein by its synthesis and degradation is critical for cell cycle progression.

AA Sequence

MGDVKESKMQITPETPGRIPVLNPFESPSDYSNLHEQTLASPSVFKSTKLPTPGKFRWSIDQLAVINPVE      1 - 70
IDPEDIHRQALYLSHSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHEGKQLSQCHSSKCTNINSDSPVG     71 - 140
KKLTIHSEKSDAACQTLLSLPVDFNLENILGDYFRADEFADQSPGNLSSSSLRRKLFLDGNGSISDSLPS    141 - 210
ASPGSPHSGVQTSLEMFYSIDLSPVKCRSPLQTPSSGQFSSSPIQASAKKYSLGSITSPSPISSPTFSPI    211 - 280
EFQIGETPLSEQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSGGTQYRTSVIQ    281 - 350
IPFTLETQGEDEEDKENIPSTDVSSPAMDAAGIHLRQFSNEASTHGTHLVVTAMSVTQNQSSASEKELAL    351 - 420
LQDVEREKDNNTVDMVDPIEIADETTWIKEPVDNGSLPMTDFVSGIAFSIENSHMCMSPLAESSVIPCES    421 - 490
SNIQMDSGYNTQNCGSNIMDTVGAESYCKESDAQTCEVESKSQAFNMKQDHTTQRCWMKTASPFQCSSP     491 - 559
//

Text Mined References (21)

PMID Year Title
25742493 2015 Bora downregulation results in radioresistance by promoting repair of double strand breaks.
24338364 2014 Bora and Aurora-A continue to activate Plk1 in mitosis.
23970419 2013 Pin1 acts as a negative regulator of the G2/M transition by interacting with the Aurora-A-Bora complex.
23592782 2013 Ataxia telangiectasia-mutated- and Rad3-related protein regulates the DNA damage-induced G2/M checkpoint through the Aurora A cofactor Bora protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19487276 2009 Aurora-A and hBora join the game of Polo.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...