Property Summary

NCBI Gene PubMed Count 19
PubMed Score 143.35
PubTator Score 13.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.014 9.5e-03
atypical teratoid / rhabdoid tumor 1.500 2.6e-05
Breast cancer 1.100 5.1e-09
colon cancer 1.500 2.4e-02
glioblastoma 1.200 5.9e-06
group 3 medulloblastoma 1.900 5.9e-06
intraductal papillary-mucinous carcinoma... 1.100 4.5e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.3e-03
lung cancer 1.400 1.4e-02
malignant mesothelioma 2.300 1.9e-08
medulloblastoma, large-cell 1.200 7.4e-04
non-small cell lung cancer 1.544 1.4e-21
osteosarcoma -1.132 4.4e-02
pediatric high grade glioma 1.300 8.5e-05
primitive neuroectodermal tumor 1.700 4.5e-05

Gene RIF (11)

AA Sequence

MGDVKESKMQITPETPGRIPVLNPFESPSDYSNLHEQTLASPSVFKSTKLPTPGKFRWSIDQLAVINPVE      1 - 70
IDPEDIHRQALYLSHSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHEGKQLSQCHSSKCTNINSDSPVG     71 - 140
KKLTIHSEKSDAACQTLLSLPVDFNLENILGDYFRADEFADQSPGNLSSSSLRRKLFLDGNGSISDSLPS    141 - 210
ASPGSPHSGVQTSLEMFYSIDLSPVKCRSPLQTPSSGQFSSSPIQASAKKYSLGSITSPSPISSPTFSPI    211 - 280
EFQIGETPLSEQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSGGTQYRTSVIQ    281 - 350
IPFTLETQGEDEEDKENIPSTDVSSPAMDAAGIHLRQFSNEASTHGTHLVVTAMSVTQNQSSASEKELAL    351 - 420
LQDVEREKDNNTVDMVDPIEIADETTWIKEPVDNGSLPMTDFVSGIAFSIENSHMCMSPLAESSVIPCES    421 - 490
SNIQMDSGYNTQNCGSNIMDTVGAESYCKESDAQTCEVESKSQAFNMKQDHTTQRCWMKTASPFQCSSP     491 - 559
//

Text Mined References (24)

PMID Year Title