Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.07
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 8.3e-07

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.387 8.3e-07

Gene RIF (1)

AA Sequence

MGNILTCCINSHCGWPRGKDAPCYESDTDIYETVAAATSESTTVEPGKLDVGATEGQDLQHISNQKMPTG      1 - 70
PPEDRLSLKFLPSSEEDNDDAKILPSPVQGSSEDNLSLVCLPRSEDDDCDDDDDDDAQILPSRVQGGCYR     71 - 140
FDSSSCSSEDNLSLVCLPRSEDDDCDDDDDDAQILPSPVQACSEDSLFLRCSLRHKDEEEEDDDDIHITA    141 - 210
RIESDLTLESLSDEEIHPG                                                       211 - 229
//

Text Mined References (9)

PMID Year Title