Property Summary

NCBI Gene PubMed Count 66
Grant Count 5
Funding $201,066.6
PubMed Score 21.60
PubTator Score 24.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (38)

PMID Text
26820536 Thus, ANKRD53 is recruited to the mitotic spindle by DDA3 and acts as a regulator of spindle dynamics and cytokinesis.
26797278 Thus, our findings identified a definite regulatory mechanism of the search and capture process for stable spindle attachment through cross-talk between spindle dynamics and KT composition mediated by DDA3 and Ska1.
26464717 no association was found between the SNPs of rs599839, rs464218 and rs6698843 at the CELSR2-PSRC1-SORT1 and the risk of coronary artery disease or ischemic stroke
25998387 DDA3 controls astral spindle formation and spindle positioning by targeting Cep290 to the centrosome. Depletion of Cep290 caused a reduction of the astral spindle, leading to misorientation of the mitotic spindle.
24674750 PSRC1 in the cholesterol gene cluster shows a significant association with coronary artery disease and its single nucleotide polymorphism regulates plasma cholesterol levels.
23652583 Thus, the EB1-based function of DDA3 links MT dynamics to directional cell migration
21473853 kinases control the function of DDA3 in the cell cycle by regulating its microtubules-polymerizing/bundling activities through sequential phosphorylation.
21426902 MCAK and CENP-E are involved in DDA3-mediated chromosome congression.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLS      1 - 70
PEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPS     71 - 140
PSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAA    141 - 210
ASEETRAAKLRVSGSGEFVGLTLKFLHPSPPGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIP    211 - 280
SAIPRPASRMPLTSRSVPPGRGALPPDSLSTRKGLPRPSTAGHRVRESGHKVPVSQRLNLPVMGATRSNL    281 - 350
QPPRKVAVPGPTR                                                             351 - 363
//

Text Mined References (73)

PMID Year Title
27697924 2016 ASB7 regulates spindle dynamics and genome integrity by targeting DDA3 for proteasomal degradation.
26820536 2016 ANKRD53 interacts with DDA3 and regulates chromosome integrity during mitosis.
26797278 2016 Ska1 cooperates with DDA3 for spindle dynamics and spindle attachment to kinetochore.
26464717 2015 Association of variants in CELSR2-PSRC1-SORT1 with risk of serum lipid traits, coronary artery disease and ischemic stroke.
25998387 2015 DDA3 targets Cep290 into the centrosome to regulate spindle positioning.
24674750 2014 CELSR2-PSRC1-SORT1 gene expression and association with coronary artery disease and plasma lipid levels in an Asian Indian cohort.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23652583 2013 DDA3 associates with microtubule plus ends and orchestrates microtubule dynamics and directional cell migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...