Property Summary

NCBI Gene PubMed Count 71
PubMed Score 23.72
PubTator Score 24.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.565 3.2e-03
adult high grade glioma 1.100 6.2e-03
Atopic dermatitis 1.100 2.1e-04
Breast cancer 1.500 7.5e-13
ductal carcinoma in situ 1.200 3.4e-03
Endometriosis 1.450 1.4e-02
glioblastoma 1.300 1.2e-02
group 4 medulloblastoma -1.500 4.7e-04
intraductal papillary-mucinous carcinoma... 1.200 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.2e-02
invasive ductal carcinoma 1.700 1.1e-03
lung cancer 1.100 1.7e-02
malignant mesothelioma 1.800 1.6e-07
ovarian cancer 1.400 8.2e-06
tuberculosis 1.200 2.9e-04

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (40)

AA Sequence

MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLS      1 - 70
PEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPS     71 - 140
PSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAA    141 - 210
ASEETRAAKLRVSGSGEFVGLTLKFLHPSPPGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIP    211 - 280
SAIPRPASRMPLTSRSVPPGRGALPPDSLSTRKGLPRPSTAGHRVRESGHKVPVSQRLNLPVMGATRSNL    281 - 350
QPPRKVAVPGPTR                                                             351 - 363
//

Text Mined References (78)

PMID Year Title