Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.28
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 416 3.9e-08

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 3.9e-08

 GO Component (1)

AA Sequence

MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGK      1 - 70
RDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQ     71 - 140
WENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPT    141 - 210
QFPIPEVKILDPDGVLAEALAMFRKTEEGD                                            211 - 240
//

Text Mined References (8)

PMID Year Title