Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.3e-09
Breast cancer 3578 1.9e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.100 1.9e-04
osteosarcoma -2.018 4.3e-09

AA Sequence

MDWKLEGSTQKVESPVLQGQEGILEETGEDGLPEGFQLLQIDAEGECQEGEILATGSTAWCSKNVQRKQR      1 - 70
HWEKIVAAKKSKRKQEKERRKANRAENPGICPQHSKRFLRALTKDKLLEAKHSGPRLCIDLSMTHYMSKK     71 - 140
ELSRLAGQIRRLYGSNKKADRPFWICLTGFTTDSPLYEECVRMNDGFSSYLLDITEEDCFSLFPLETLVY    141 - 210
LTPDSEHALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRNQNGKNYHSEILAIN    211 - 280
QVFDILSTYLETHNWPEALKKGVSSGKGYILRNSVE                                      281 - 316
//

Text Mined References (6)

PMID Year Title