Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2627 3.9e-06
osteosarcoma 7766 3.4e-05
ovarian cancer 8297 2.7e-04

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.500 3.9e-06
osteosarcoma 1.263 3.4e-05
ovarian cancer -1.300 2.7e-04

AA Sequence

MAESGLAMWPSLLLLLLLPGPPPVAGLEDAAFPHLGESLQPLPRACPLRCSCPRVDTVDCDGLDLRVFPD      1 - 70
NITRAAQHLSLQNNQLQELPYNELSRLSGLRTLNLHNNLISSEGLPDEAFESLTQLQHLCVAHNKLSVAP     71 - 140
QFLPRSLRVADLAANQVMEIFPLTFGEKPALRSVYLHNNQLSNAGLPPDAFRGSEAIATLSLSNNQLSYL    141 - 210
PPSLPPSLERLHLQNNLISKVPRGALSRQTQLRELYLQHNQLTDSGLDATTFSKLHSLEYLDLSHNQLTT    211 - 280
VPAGLPRTLAILHLGRNRIRQVEAARLHGARGLRYLLLQHNQLGSSGLPAGALRPLRGLHTLHLYGNGLD    281 - 350
RVPPALPRRLRALVLPHNHVAALGARDLVATPGLTELNLAYNRLASARVHHRAFRRLRALRSLDLAGNQL    351 - 420
TRLPMGLPTGLRTLQLQRNQLRMLEPEPLAGLDQLRELSLAHNRLRVGDIGPGTWHELQALQVRHRLVSH    421 - 490
TVPRAPPSPCLPCHVPNILVSW                                                    491 - 512
//

Text Mined References (4)

PMID Year Title