Property Summary

Ligand Count 1
NCBI Gene PubMed Count 7
PubMed Score 0.03
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Condyloma acuminatum 7
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL      1 - 70
EPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHS     71 - 140
FGGGTGSGFASLLMERLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLVHKFDLMYAKWAFVHWYVGEGMEEGEFSE    351 - 420
AREDLAALEKDCEEVGVDSVEAEAEEGEAY                                            421 - 450
//

Text Mined References (14)

PMID Year Title