Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.03
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Condyloma acuminatum 7

Expression

Synonym

Accession Q6PEY2
Symbols

Gene

Gene RIF (4)

PMID Text
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
21167302 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15698476 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15691386 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL      1 - 70
EPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHS     71 - 140
FGGGTGSGFASLLMERLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLVHKFDLMYAKWAFVHWYVGEGMEEGEFSE    351 - 420
AREDLAALEKDCEEVGVDSVEAEAEEGEAY                                            421 - 450
//

Text Mined References (14)

PMID Year Title
26972003 2016 ?-Tubulin Tyrosination and CLIP-170 Phosphorylation Regulate the Initiation of Dynein-Driven Transport in Neurons.
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
25558065 2015 Accelerating novel candidate gene discovery in neurogenetic disorders via whole-exome sequencing of prescreened multiplex consanguineous families.
25416956 2014 A proteome-scale map of the human interactome network.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
23907097 2013 Distinctive patterns of DNA methylation associated with Parkinson disease: identification of concordant epigenetic changes in brain and peripheral blood leukocytes.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...