Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.33
PubTator Score 3.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTMLGFGFLCHSQ      1 - 70
FLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLADCLVPYSRALYRRRRAPQPR     71 - 140
QIRASPGSQAVPTSGKVWV                                                       141 - 159
//

Text Mined References (10)

PMID Year Title