Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.41
PubTator Score 2.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
26375552 High CX25 expression is associated with leukemia.

AA Sequence

MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFP      1 - 70
ISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLV     71 - 140
LFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCC    141 - 210
LQKYLKKPQVLSV                                                             211 - 223
//

Text Mined References (11)

PMID Year Title
26375552 2015 Cx25 contributes to leukemia cell communication and chemosensitivity.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12881038 Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12108537 2002 Structural and functional diversity of connexin genes in the mouse and human genome.
12064583 2001 Cloning and functional expression of a novel human connexin-25 gene.
More...