Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.41
PubTator Score 2.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFP      1 - 70
ISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLV     71 - 140
LFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCC    141 - 210
LQKYLKKPQVLSV                                                             211 - 223
//

Text Mined References (11)

PMID Year Title