Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.0e-04
diabetes mellitus 1728 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

 HCA RNA Cell Line (1)

AA Sequence

MSCPNYCSGNSNSGSLRTSRHIPLTSIDLCPTSVSCGDVLYLPTSSQDHTWVTDNCQETCGEPTSCQPVH      1 - 70
CETGNLETSCGSSTAYYVPRPCQGSSFLPASFFSSSCLPVSCRPQRYVSSGCRPLRPLLNSYQPIGDCVP     71 - 140
NAYRPQFCLSKSCQPQNLLTSGCQPSSCLAYRPQSLHVVSSSLRPLGPLFSGCQPLTHVFSTCRPSCSGL    141 - 210
//

Text Mined References (9)

PMID Year Title