Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.96
PubTator Score 6.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.200 5.8e-06
astrocytic glioma -2.700 1.9e-03
Astrocytoma, Pilocytic -1.700 1.2e-07
atypical teratoid / rhabdoid tumor -1.600 4.1e-03
ependymoma -2.700 1.8e-03
glioblastoma -2.000 9.0e-09
medulloblastoma, large-cell -2.100 7.0e-04
oligodendroglioma -2.600 3.3e-03
pituitary cancer 1.900 2.2e-05
sonic hedgehog group medulloblastoma -1.300 4.7e-03
subependymal giant cell astrocytoma -2.243 9.8e-03

Gene RIF (4)

AA Sequence

MASIIARVGNSRRLNAPLPPWAHSMLRSLGRSLGPIMASMADRNMKLFSGRVVPAQGEETFENWLTQVNG      1 - 70
VLPDWNMSEEEKLKRLMKTLRGPAREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQA     71 - 140
QGEKASLYVIRLEVQLQNAIQAGIIAEKDANRTRLQQLLLGGELSRDLRLRLKDFLRMYANEQERLPNFL    141 - 210
ELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILV    211 - 280
ESQDPPLPSWGAPPLRDRARPQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYC    281 - 350
GEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSEPL                      351 - 402
//

Text Mined References (14)

PMID Year Title