Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.80
PubTator Score 6.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.32000262476927E-7
pediatric high grade glioma 2712 3.02589135657646E-7
pituitary cancer 1972 2.15266291357877E-5
glioblastoma 5572 2.92135885270128E-5
medulloblastoma, large-cell 6234 6.95882853457743E-4
ependymoma 2514 0.00181324988319658
astrocytic glioma 2241 0.00194386950292261
oligodendroglioma 2849 0.00328146369855234
atypical teratoid / rhabdoid tumor 4369 0.00406439001311297
sonic hedgehog group medulloblastoma 1482 0.00470061092525426
subependymal giant cell astrocytoma 2287 0.00976025460483991
Disease Target Count Z-score Confidence
Intellectual disability 573 3.89 1.9
Nodular goiter 2 3.45 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.700 0.002
ependymoma -2.700 0.002
oligodendroglioma -2.600 0.003
glioblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -1.600 0.004
medulloblastoma, large-cell -2.100 0.001
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -1.700 0.000
sonic hedgehog group medulloblastoma -1.300 0.005
subependymal giant cell astrocytoma -2.243 0.010
pituitary cancer 1.900 0.000

Synonym

Accession Q6PEW1 B3KV48 Q6PID5 Q8N1C1
Symbols SIZN
SIZN1
PNMA7A

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG

Gene RIF (4)

PMID Text
21739307 The ZCCHC12 gene may be a novel diagnostic molecular marker of primary papillary thyroid carcinoma
19578717 ZCCHC12 enhanced the transcriptional activities of activator protein 1 (AP-1) and cAMP response element binding protein (CREB) as a coactivator
19416967 Data indicate that the SIMs in Sizn1 are required for its PML-NB localization and for the full transcriptional co-activation function in BMP signaling.
18798319 data implicate SIZN1 as a candidate gene for X-linked mental retardation and/or as a neurocognitive functional modifier

AA Sequence

MASIIARVGNSRRLNAPLPPWAHSMLRSLGRSLGPIMASMADRNMKLFSGRVVPAQGEETFENWLTQVNG      1 - 70
VLPDWNMSEEEKLKRLMKTLRGPAREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQA     71 - 140
QGEKASLYVIRLEVQLQNAIQAGIIAEKDANRTRLQQLLLGGELSRDLRLRLKDFLRMYANEQERLPNFL    141 - 210
ELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILV    211 - 280
ESQDPPLPSWGAPPLRDRARPQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYC    281 - 350
GEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSEPL                      351 - 402
//

Text Mined References (13)

PMID Year Title
26522270 2015 NAA10 mutation causing a novel intellectual disability syndrome with Long QT due to N-terminal acetyltransferase impairment.
25416956 2014 A proteome-scale map of the human interactome network.
21739307 2012 ZCCHC12, a potential molecular marker of papillary thyroid carcinoma: a preliminary study.
21172456 XLMR candidate mouse gene, Zcchc12 (Sizn1) is a novel marker of Cajal-Retzius cells.
19578717 2009 Human ZCCHC12 activates AP-1 and CREB signaling as a transcriptional co-activator.
19416967 2009 SUMO interaction motifs in Sizn1 are required for promyelocytic leukemia protein nuclear body localization and for transcriptional activation.
18798319 2008 Evidence that SIZN1 is a candidate X-linked mental retardation gene.
18160706 2008 Sizn1 is a novel protein that functions as a transcriptional coactivator of bone morphogenic protein signaling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...